SLiMSuite REST Server

EdwardsLab Homepage
EdwardsLab Blog
SLiMSuite Blog
REST Pages
REST Status
REST Tools
REST Alias Data
REST Sitemap

SLiMSuite SLiMFinder Server

# Output for SLiMFinder V5.2.3: Tue Dec  8 23:27:22 2015
# 201 warnings; 20 errors: see log output (below) for details.
# JobID: 15120800036

Your SLiMFinder job has finished running and outputs have been parsed. Click on tabs to see server output. (Mouseover for description.)

The outfmt tab contains more information on the outputs. Click here for SLiMFinder help/documentation.

Content for individual tabs can be returned using &rest=X, where X is the tab name (e.g. &rest=log). Full output can be returned as text using &rest=full and parsed using SLiMParser:

python PATH/ restin=JOBID restout=T [password=X] [restbase=X]

JobID 15120800036 (slimfinder) Finished.
No queue.
Run Started: 2015-12-08 23:27:22; PID=39031
Run finished: 2015-12-09 00:02:11

SLiMs and SLiMFinder

Short linear motifs (SLiMs) in proteins are functional microdomains of fundamental importance in many biological
systems. SLiMs typically consist of a 3 to 10 amino acid stretch of the primary protein sequence, of which as few
as two sites may be important for activity. SLiMFinder is a SLiM discovery program building on the principles of
the SLiMDisc software for accounting for evolutionary relationships between input proteins. This stops results
being dominated by motifs shared for reasons of history, rather than function. SLiMFinder runs in two phases:
(1) SLiMBuild constructs the motif search space based on number of defined positions, maximum length of "wildcard
spacers" and allowed amino acid ambiguities; (2) SLiMChance assesses the over-representation of all motifs,
correcting for the size of the SLiMBuild search space. This gives SLiMFinder high specificity.

Protein sequences can be masked prior to SLiMBuild. Disorder masking (using IUPred predictions) is highly
recommended. Other masking options are described in the manual and/or literature.

Running SLiMFinder

The standared REST server call for SLiMFinder is in the form:

Run with &rest=docs for program documentation and options. A plain text version is accessed with &rest=help.
&rest=OUTFMT can be used to retrieve individual parts of the output, matching the tabs in the default
(&rest=format) output. Individual OUTFMT elements can also be parsed from the full (&rest=full) server output,
which is formatted as follows:
... contents for OUTFMT section ...

More options are available through the SLiMFinder server:

After running, click on the main tab to see overall SLiM predictions. If any SLiMS have been predicted, the
occ tab will have details of which proteins (and where) they occur.

If no SLiMs are returned: [1] Try altering the masking settings. (Disorder masking is recommended. Conservation
masking can sometimes help but it depend on the dataset.) [2] Try relaxing the probability cutoff. Set
[probcut=1.0]{cmd:probcut} to see the best motifs, regardless of significance. (You may also want to reduce the [topranks=X]{cmd:topranks}

Available REST Outputs

main = Main results table of predicted SLiM patterns (if any) [[extras=-1]{cmd:extras}]
occ = Occurrence table showing individual SLiM occurrences in input proteins [[extras=0]{cmd:extras}]
upc = List of Unrelated Protein Clusters (UPC) used for evolutionary corrections [[extras=0]{cmd:extras}]
cloud = Predicted SLiM "cloud" output, which groups overlapping motifs [[extras=1]{cmd:extras}]
seqin = Input sequence data [[extras=-1]{cmd:extras}]
slimdb = Parsed input sequences in fasta format, used for UPC generation etc. [[extras=0]{cmd:extras}]
masked = Masked input sequences (masked residues marked with X) [[extras=1]{cmd:extras}]
mapping = Fasta format with positions of SLiM occurrences aligned [[extras=1]{cmd:extras}]
motifaln = Fasta format of individual SLiM alignments (unmasked sequences) [[extras=1]{cmd:extras}]
maskaln = Fasta format of individual SLiM alignments (masked sequences) [[extras=1]{cmd:extras}]

Additional REST Outputs [extras>1]

To get additional REST outputs, set &extras=2 or &extras=3. This may increase run times noticeably,
depending on the number of SLiMs returned.

motifs = SLiM predictions reformatted in plain motif format for CompariMotif [[extras=2]{cmd:extras}]
compare = Results of all-by-all CompariMotif search of predicted SLiMs [[extras=2]{cmd:extras}]
xgmml = SLiMs, occurrences and motif relationships in a Cytoscape-compatible network [[extras=2]{cmd:extras}]
dismatrix = Input sequence distance matrix [[extras=3]{cmd:extras}]
rank = Main table in SLiMDisc output format [[extras=3]{cmd:extras}]
dat.rank = Occurrence table in SLiMDisc output format [[extras=3]{cmd:extras}]
teiresias = Motif prediction output in TEIRESIAS format [[extras=3]{cmd:extras} [teiresias=T]{cmd:teiresias}]
teiresias.fasta = TEIRESIAS masked fasta output [[extras=3]{cmd:extras} [teiresias=T]{cmd:teiresias}]
Dataset RunID Masking Build Chance RunTime SeqNum UPNum AANum MotNum Rank Sig Pattern IC Occ Support UP ExpUP Prob Cloud CloudSeq CloudUP
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 1 0.00e+00 P..C..C.[KR].[FY] 4.54 14 9 9 0.002 5.29e-32 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 2 0.00e+00 P..C..C..[AS][FY] 4.54 10 9 9 0.003 2.66e-30 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 3 0.00e+00 P..C..C.[KR].F 4.77 12 7 7 8.43e-04 2.74e-26 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 4 0.00e+00 [ST]..KP..C..C 4.77 11 8 8 0.003 8.78e-26 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 5 0.00e+00 C..C.[KR][AS][FY] 4.31 9 8 8 0.003 1.48e-25 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 6 3.33e-16 [KR]P..C..C.[KR] 4.54 15 8 8 0.004 1.24e-24 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 7 1.89e-15 C..C.[KR].[FY] 3.54 18 9 9 0.020 4.31e-22 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 8 3.00e-15 H..E..[FY].C..C 4.77 9 6 6 4.94e-04 1.17e-23 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 9 3.44e-15 KP..C..C.{1,2}R 5.00 10 7 7 0.002 1.31e-23 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 10 3.55e-15 [ST]..[KR]P..C..C 4.54 15 8 8 0.006 1.36e-23 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 11 8.22e-15 P..C..C.[KR][AS] 4.54 9 8 8 0.007 3.18e-23 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 12 5.31e-14 PY.C..C.[KR] 4.77 9 6 6 7.97e-04 2.05e-22 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 13 6.45e-14 C..C..[AS][FY] 3.54 12 9 9 0.030 1.49e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 14 1.82e-13 H..E.P..C..C 5.00 8 6 6 9.79e-04 7.04e-22 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 15 6.08e-13 E.P[FY].C..C 4.77 8 6 6 0.001 2.34e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 16 6.37e-13 C..CG[KR].[FY] 4.54 6 6 6 0.001 2.46e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 17 8.07e-13 P..C..C.[KR] 3.77 17 9 9 0.040 1.87e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 18 8.12e-13 C..C..S[FY] 3.77 8 8 8 0.020 1.88e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 19 1.07e-12 H[ST]..[KR]P..C 4.54 14 8 8 0.012 4.13e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 20 1.13e-12 P..C..C..[AS]F 4.77 7 6 6 0.001 4.38e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 21 1.18e-12 R.H..E..[FY].C 4.77 8 6 6 0.001 4.56e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 22 1.50e-12 KP..C..C 4.00 11 8 8 0.021 3.48e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 23 2.13e-12 RP[FHY].C..C 4.63 6 6 6 0.001 8.21e-21 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 24 3.11e-12 P..C..C..S[FY] 4.77 6 6 6 0.002 1.20e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 25 4.64e-12 [HY].C..C..[AS][FY] 4.31 6 6 6 0.002 1.79e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 26 4.72e-12 [KR]P[FY].C..C 4.54 9 6 6 0.002 1.82e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 27 6.20e-12 C..C.[KR].F 3.77 16 7 7 0.011 1.44e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 28 6.66e-12 C..C.[KR][AS]F 4.54 7 6 6 0.002 2.57e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 29 8.08e-12 C..C..[AS][FY]K 4.54 6 6 6 0.002 3.12e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 30 1.21e-11 [KR]P..C..C..[AS] 4.54 7 7 7 0.007 4.66e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 31 1.97e-11 R..[ST]..[KR]P..C 4.54 12 8 8 0.018 7.59e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 32 2.05e-11 H.R.H..E.P 5.00 9 7 7 0.007 7.91e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 33 2.26e-11 P[HY].C..C.[KR] 4.54 11 6 6 0.002 8.71e-20 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 34 2.83e-11 H..E.P[FY].C 4.77 8 6 6 0.002 1.09e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 35 3.24e-11 P..C..C.[KR]..K 4.77 6 6 6 0.002 1.25e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 36 3.69e-11 P..C..C..[AS] 3.77 10 9 9 0.062 8.55e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 37 3.98e-11 P..C..C.{1,2}R.{0,1}S 5.00 9 7 7 0.008 1.54e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 38 8.96e-11 P[FY].C..C 3.77 12 7 7 0.016 2.07e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 39 9.85e-11 R.H..E.P..C 5.00 8 6 6 0.003 3.80e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 40 1.46e-10 [KR].Y.C..C.K 4.77 8 5 5 6.27e-04 5.63e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 41 1.46e-10 R.[FHY].C..C 3.63 10 7 7 0.017 3.38e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 42 1.70e-10 P..C..C.{1,2}R 4.00 11 8 8 0.038 3.94e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 43 2.24e-10 H.R.H[ST]..K 4.77 12 7 7 0.010 8.63e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 44 2.54e-10 R.[HY].C..C.K 4.77 6 5 5 7.01e-04 9.81e-19 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 45 2.78e-10 [KR]P..C..C 3.77 18 8 8 0.041 6.45e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 46 2.91e-10 P..C..C..[AS].K 4.77 6 6 6 0.003 1.12e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 47 3.45e-10 C..C.{1,2}R.{0,1}F 4.00 9 7 7 0.019 7.99e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 48 3.58e-10 K.{0,1}P..C..C 4.00 13 8 8 0.042 8.30e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 49 5.81e-10 PY.C..C 4.00 9 6 6 0.007 1.34e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 50 5.81e-10 [KR].[FY].C..C 3.54 13 7 7 0.020 1.35e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 51 8.21e-10 C..C.[KR].F.[HR] 4.54 10 5 5 8.87e-04 3.17e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 52 8.94e-10 D.P[IL]DL 4.77 8 8 8 0.028 3.45e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 53 1.03e-09 P..C..CG..[FY] 4.77 5 5 5 9.28e-04 3.99e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 54 1.13e-09 R.H[ST].E.P 4.77 10 8 8 0.029 4.36e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 55 1.13e-09 H.R.H[ST].E 4.77 9 7 7 0.013 4.37e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 56 1.31e-09 [ST].E.P..C..C 4.77 8 6 6 0.004 5.03e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 57 1.36e-09 C..C.RS[FY] 4.77 5 5 5 9.81e-04 5.25e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 58 1.41e-09 Y.C..C.K.F 5.00 8 4 4 1.13e-04 5.43e-18 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 59 2.79e-09 L..H.R.H[ST] 4.77 9 7 7 0.014 1.08e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 60 2.82e-09 C..C.[KR].F..S 4.77 7 5 5 0.001 1.09e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 61 2.92e-09 H.R.H.GE 5.00 8 6 6 0.005 1.13e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 62 3.01e-09 Y.C..C.[KR] 3.77 12 6 6 0.010 6.97e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 63 4.68e-09 KP..C..CG 5.00 5 5 5 0.001 1.81e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 64 5.16e-09 P[IL]DLS 4.77 9 9 9 0.068 1.99e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 65 5.51e-09 R.[HR]..E.P[FHY] 4.40 10 8 8 0.036 2.13e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 66 5.70e-09 C..CG..[FY] 3.77 6 6 6 0.011 1.32e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 67 6.33e-09 C..C.[KR].[FY]K 4.54 5 5 5 0.001 2.44e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 68 6.48e-09 P[FHY].C..C 3.63 14 7 7 0.029 1.50e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 69 6.63e-09 L..H.R.H.G 5.00 8 6 6 0.006 2.56e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 70 6.70e-09 C..C..[AS]F.[HR] 4.54 5 5 5 0.001 2.59e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 71 1.02e-08 H.R.H.G..P 5.00 8 6 6 0.006 3.92e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 72 1.04e-08 C..C.{1,2}R.{0,1}F.{0,2}S 5.00 8 6 6 0.006 4.00e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 73 1.57e-08 P..C..C.{1,2}R.{0,1}F 5.00 7 5 5 0.002 6.05e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 74 1.86e-08 L..H.R.H..E 5.00 8 6 6 0.007 7.17e-17 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 75 2.25e-08 P.DLS 4.00 13 13 13 0.59 5.21e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 76 2.72e-08 C.[KR].F.[HR]..H 4.54 5 5 5 0.002 1.05e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 77 3.02e-08 E..[FY].C..C 3.77 10 6 6 0.014 7.00e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 78 3.24e-08 R.H[ST]..[KR]P 4.54 14 8 8 0.044 1.25e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 79 3.29e-08 R.H..E.P[FY] 4.77 8 6 6 0.007 1.27e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 80 3.42e-08 Q..P[LMV]DL 4.63 8 8 8 0.045 1.32e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 81 4.43e-08 P..C..C.RS 5.00 5 5 5 0.002 1.71e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 82 4.70e-08 Y.CD.C.K 5.00 5 4 4 2.71e-04 1.81e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 83 4.92e-08 R.H..E[KR]P 4.77 9 7 7 0.022 1.90e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 84 5.10e-08 T.H.R.H[ST] 4.77 6 6 6 0.008 1.97e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 85 5.87e-08 C..C..[AS]F 3.77 9 6 6 0.016 1.36e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 86 6.37e-08 H[FLM]R.H[ST] 4.40 8 7 7 0.022 2.46e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 87 6.51e-08 C..C..[AS]..[HR]..H 4.54 5 5 5 0.002 2.51e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 88 6.60e-08 [KR]P.QC..C 4.77 7 5 5 0.002 2.55e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 89 6.68e-08 C..C.[KR][AS] 3.54 10 8 8 0.081 1.55e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 90 6.81e-08 H.R..[ST]..KP 4.77 12 7 7 0.023 2.63e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 91 7.20e-08 H[ST].E.P..C 4.77 8 6 6 0.008 2.78e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 92 7.39e-08 S..KP..C..C 5.00 8 5 5 0.002 2.85e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 93 8.61e-08 [HY].C..C.K.F 4.77 11 4 4 3.15e-04 3.32e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 94 9.11e-08 C..CGK.F 5.00 4 4 4 3.20e-04 3.51e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 95 1.18e-07 Y.C..C.K 4.00 10 5 5 0.005 2.72e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 96 1.53e-07 P..C..CG[KR] 4.77 5 5 5 0.003 5.89e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 96 1.53e-07 [KR]P..C..CG 4.77 8 5 5 0.003 5.89e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 98 1.67e-07 H[FLM]..H[ST]..K 4.40 8 7 7 0.026 6.42e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 99 1.86e-07 C..C.K.F 4.00 13 5 5 0.006 4.30e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 100 1.95e-07 RP..C..C 4.00 7 6 6 0.020 4.51e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 101 1.98e-07 Y.C..C..S[FY] 4.77 4 4 4 3.88e-04 7.63e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 102 2.01e-07 C..C.{1,2}R.{0,1}S 4.00 10 8 8 0.093 4.66e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 103 2.39e-07 H.R.H[ST]G 4.77 8 6 6 0.010 9.21e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 104 2.51e-07 [FY].C..C.[KR] 3.54 14 6 6 0.020 5.80e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 105 2.53e-07 P[ILMV][DE]L 3.31 22 19 19 2.52 5.86e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 106 2.54e-07 C..[AS]F.[HR]..H 4.54 5 5 5 0.003 9.78e-16 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 107 2.82e-07 PY.C..C.K 5.00 7 4 4 4.24e-04 1.09e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 108 3.31e-07 H.{0,1}R.{1,2}H..E.P 5.00 9 7 7 0.028 1.28e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 109 3.38e-07 P..C..C.K.F 5.00 9 4 4 4.44e-04 1.30e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 110 3.45e-07 H.R..[ST].E.P 4.77 9 7 7 0.028 1.33e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 111 3.63e-07 Y.C..C.{0,1}K.{1,2}F 5.00 8 4 4 4.52e-04 1.40e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 112 3.70e-07 H.R.H[ST] 3.77 15 9 9 0.17 8.57e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 113 4.40e-07 G..PY.C..C 5.00 6 4 4 4.74e-04 1.70e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 114 5.00e-07 H.R.H..E..[FY] 4.77 7 5 5 0.003 1.93e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 115 5.17e-07 E[KR]P..C..C 4.77 7 5 5 0.003 1.99e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 116 6.14e-07 R..[ST].E.P..C 4.77 8 6 6 0.012 2.37e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 117 6.18e-07 P[HY].C..C..[AS] 4.54 5 5 5 0.003 2.38e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 118 6.71e-07 C..CD[KR].F 4.77 4 4 4 5.27e-04 2.59e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 119 6.90e-07 L..H.{1,2}R.H 4.00 12 9 9 0.19 1.60e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 120 7.30e-07 R.H.GE.P 5.00 8 6 6 0.012 2.82e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 121 7.32e-07 F.[HR]..HL..H 4.77 5 5 5 0.003 2.82e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 122 8.63e-07 T..R.[FH].C..C 4.77 4 4 4 5.61e-04 3.33e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 123 8.92e-07 L..[HR].R[IL][HK] 4.31 10 8 8 0.067 3.44e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 124 9.89e-07 R.H..E.P 4.00 11 9 9 0.19 2.29e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 125 9.92e-07 EH.{1,2}RI.S 5.00 6 6 6 0.013 3.83e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 126 1.05e-06 H.R.H.G.K 5.00 7 5 5 0.004 4.05e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 127 1.06e-06 HL..H.R.H 5.00 8 5 5 0.004 4.07e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 128 1.16e-06 P.DLS.{1,2}K 5.00 8 8 8 0.069 4.46e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 129 1.22e-06 [HY].C..C.[KR] 3.54 15 6 6 0.027 2.82e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 130 1.37e-06 G.{0,1}K.Y.C..C 5.00 6 4 4 6.30e-04 5.30e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 131 1.41e-06 L.EH.{1,2}R.H 5.00 8 6 6 0.014 5.44e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 132 1.41e-06 H..E..[FY].C 3.77 9 6 6 0.027 3.27e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 133 1.46e-06 T.{1,2}K.{0,1}P..C..C 5.00 5 5 5 0.004 5.64e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 134 1.67e-06 LK.[HR].R.[HK] 4.54 7 7 7 0.036 6.46e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 135 1.73e-06 KP..C.{0,1}D.{0,1}C 5.00 5 5 5 0.004 6.68e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 136 2.02e-06 R.[HY].C..C..A 4.77 4 4 4 6.94e-04 7.77e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 137 2.34e-06 [HY].C..C.[KR][AS] 4.31 7 5 5 0.004 9.03e-15 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 138 2.36e-06 E.P..C..C 4.00 8 6 6 0.030 5.47e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 139 2.41e-06 C..CG[KR] 3.77 7 6 6 0.030 5.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 140 2.62e-06 PY.C..C.{1,2}R 5.00 6 4 4 7.41e-04 1.01e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 141 2.75e-06 HS..KP..C 5.00 8 5 5 0.004 1.06e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 142 2.78e-06 R.H[ST].E[KR] 4.54 9 7 7 0.038 1.07e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 143 2.98e-06 E..[FY]QC..C 4.77 4 4 4 7.65e-04 1.15e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 144 3.08e-06 C..C..SF 4.00 5 5 5 0.010 7.13e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 145 3.10e-06 H.G..P..C..C 5.00 9 4 4 7.73e-04 1.20e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 146 3.12e-06 C..C.[KR]..K 3.77 6 6 6 0.031 7.23e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 147 3.49e-06 P[FY]QC..C 4.77 5 4 4 7.96e-04 1.35e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 148 3.50e-06 R.[HR]..E.P 3.77 13 11 11 0.49 8.10e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 149 3.61e-06 [HR].[KR].[HK].[AG]E 4.07 11 9 9 0.14 1.39e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 150 3.86e-06 Y.C..C.{0,1}K 4.00 10 5 5 0.011 8.93e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 151 3.97e-06 H.R.H..EK 5.00 7 5 5 0.005 1.53e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 152 4.09e-06 E..[FY].C..CG 4.77 4 4 4 8.28e-04 1.58e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 153 4.38e-06 T..RP..C..C 5.00 4 4 4 8.42e-04 1.69e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 154 4.47e-06 [LV]..[HR].[KR].[HK]..E 4.07 12 9 9 0.14 1.73e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 155 4.63e-06 PY.C..C.{0,1}K 5.00 7 4 4 8.54e-04 1.79e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 156 4.80e-06 C..C.[KR][AS].K 4.54 5 5 5 0.005 1.85e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 157 4.86e-06 [HY].C..C..[AS]F 4.54 4 4 4 8.65e-04 1.88e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 158 5.00e-06 QPL.[LV][ST] 4.54 9 9 9 0.15 1.93e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 159 5.32e-06 P..C..C..[AS]..[HR] 4.54 5 5 5 0.005 2.05e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 160 5.96e-06 H.G..PY.C 5.00 6 4 4 9.10e-04 2.30e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 161 6.51e-06 P..C..C 3.00 20 9 9 0.38 9.04e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 162 6.52e-06 C.{0,1}D.{0,1}CD..F 5.00 4 4 4 9.31e-04 2.52e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 163 6.54e-06 H[FLM]R.H 3.63 10 8 8 0.14 1.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 164 6.78e-06 Q..P.DL.[LMV] 4.63 7 7 7 0.044 2.62e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 165 7.07e-06 C..C.K.F[ST] 4.77 6 4 4 9.49e-04 2.73e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 166 7.65e-06 C..C.K.F[AS] 4.77 6 4 4 9.68e-04 2.95e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 167 7.72e-06 [HY].C..C.K..K 4.77 4 4 4 9.71e-04 2.98e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 168 7.75e-06 P[FY].C..CG 4.77 5 4 4 9.71e-04 2.99e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 169 8.23e-06 P.DL 3.00 26 21 21 5.05 1.14e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 170 8.54e-06 H.R.H..E 4.00 9 7 7 0.081 1.98e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 171 9.56e-06 KP..C..C.R 5.00 4 4 4 0.001 3.69e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 171 9.56e-06 RP..C..C.K 5.00 5 4 4 0.001 3.69e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 173 9.90e-06 Q..P.DL[ST] 4.77 7 7 7 0.046 3.82e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 174 1.06e-05 P.DL..K.{0,2}R 5.00 7 7 7 0.046 4.11e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 175 1.08e-05 P..C..C..S 4.00 6 6 6 0.038 2.49e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 176 1.10e-05 G.Y.Q.M..R 5.00 4 4 4 0.001 4.24e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 177 1.18e-05 H.{0,1}R.{1,2}H.GE 5.00 8 6 6 0.020 4.57e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 178 1.23e-05 [HY].C..C..[AS] 3.54 9 6 6 0.039 2.85e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 179 1.28e-05 H..E[KR]P..C 4.77 7 5 5 0.006 4.94e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 180 1.36e-05 H.R..[ST]GE 4.77 8 6 6 0.020 5.23e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 181 1.44e-05 R..S..KP..C 5.00 8 5 5 0.006 5.55e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 182 1.48e-05 H[KR]..[HY].[AG].[KR] 4.07 7 7 7 0.049 5.73e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 183 1.54e-05 K.[HR].R[IL][HK] 4.31 7 7 7 0.049 5.93e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 184 1.55e-05 KP.QC..C 5.00 4 4 4 0.001 5.99e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 185 1.57e-05 R.H[ST]GE 4.77 8 6 6 0.021 6.06e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 186 1.64e-05 HT..R.[FH].C 4.77 4 4 4 0.001 6.33e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 187 1.74e-05 [KR].[FY].C..CG 4.54 6 4 4 0.001 6.71e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 188 1.82e-05 H..RI..IW 5.00 3 3 3 7.77e-05 7.02e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 189 1.83e-05 D.PLDL 5.00 6 6 6 0.021 7.07e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 190 1.91e-05 S.L..H[KR]..H 4.77 6 6 6 0.021 7.36e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 191 1.96e-05 P.DL[ST].K 4.77 7 7 7 0.051 7.55e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 192 2.01e-05 C..C.[KR][AS]..[HR] 4.31 5 5 5 0.007 7.76e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 193 2.10e-05 PLDLS 5.00 7 7 7 0.051 8.11e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 194 2.10e-05 L..H.R..[ST]..K 4.77 8 6 6 0.022 8.11e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 195 2.19e-05 H.{1,2}Y.{0,1}YC 4.00 5 5 5 0.015 5.08e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 196 2.20e-05 C..C..[AS].K 3.77 6 6 6 0.043 5.10e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 197 2.27e-05 G..P[HY].C..C 4.77 8 4 4 0.001 8.74e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 198 2.30e-05 L..H.R.H 4.00 10 7 7 0.094 5.32e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 199 2.39e-05 H.R.HS..K 5.00 8 5 5 0.007 9.22e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 200 2.52e-05 Y.C..CD..F 5.00 4 3 3 8.66e-05 9.73e-14 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 201 2.59e-05 Y.C..C 3.00 14 6 6 0.088 3.59e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 202 2.66e-05 P..C..C.K..K 5.00 4 4 4 0.001 1.03e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 203 2.68e-05 H.G.I..IW 5.00 3 3 3 8.83e-05 1.03e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 204 2.68e-05 L..H.{0,1}R.{1,2}H.G 5.00 8 6 6 0.023 1.03e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 205 2.76e-05 M.H.Y.YC 5.00 3 3 3 8.92e-05 1.06e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 206 2.89e-05 C.{1,2}C.{1,2}R 3.00 15 11 11 0.88 4.01e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 207 2.94e-05 L..H.R..[ST]G 4.77 8 6 6 0.023 1.13e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 208 3.06e-05 P..C.{0,1}D.{0,1}C.{1,2}R 5.00 5 5 5 0.007 1.18e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 209 3.15e-05 HA..I..IW 5.00 3 3 3 9.33e-05 1.22e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 210 3.26e-05 H.{0,1}L..H.R.H 5.00 13 5 5 0.007 1.26e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 211 3.29e-05 C.[DE]C.[KR].F 4.54 4 4 4 0.001 1.27e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 212 3.86e-05 H..E..[FY]QC 4.77 4 4 4 0.001 1.49e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 213 4.09e-05 H.{0,1}R.{1,2}H.G..P 5.00 8 6 6 0.024 1.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 214 4.10e-05 MN..Y.YC 5.00 3 3 3 1.02e-04 1.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 215 4.26e-05 [FY].C..C 2.77 18 7 7 0.18 5.92e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 216 4.30e-05 H.R..[ST]G..P 4.77 8 6 6 0.024 1.66e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 217 4.44e-05 R.{1,2}H.GE.P 5.00 10 6 6 0.025 1.71e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 218 4.54e-05 R.H.GEK 5.00 7 5 5 0.008 1.75e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 219 4.74e-05 E.P.QC..C 5.00 4 4 4 0.002 1.83e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 220 4.79e-05 H.{1,2}Y.{0,1}YC.{1,2}R 5.00 4 4 4 0.002 1.85e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 221 4.84e-05 Y.C..CD 4.00 5 4 4 0.004 1.12e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 222 5.05e-05 R.H[ST]G..P 4.77 8 6 6 0.025 1.95e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 223 5.06e-05 Y.CD.C 4.00 5 4 4 0.004 1.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 224 5.50e-05 [ST]..KP..C 3.77 11 8 8 0.19 1.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 225 5.68e-05 E.{0,1}PN.K.R 5.00 6 6 6 0.026 2.19e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 226 5.71e-05 IK.E 3.00 19 15 15 2.30 7.94e-10 2 19 19
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 227 5.86e-05 R.R..Q.[MV]..R 4.77 5 5 5 0.008 2.26e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 228 5.95e-05 S.[IL]..K[MV].E 4.54 7 7 7 0.060 2.30e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 229 5.97e-05 T.H.R.H 4.00 7 6 6 0.051 1.38e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 230 6.04e-05 R.T..E.N.K 5.00 5 5 5 0.008 2.33e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 231 6.10e-05 C..C.[KR] 2.77 23 9 9 0.49 8.47e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 232 6.14e-05 [HR]H[FILM]..H 3.31 13 9 9 0.31 1.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 233 6.33e-05 E[KR].[FY].C..C 4.54 6 4 4 0.002 2.44e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 234 6.41e-05 M..RY.YC 5.00 3 3 3 1.18e-04 2.47e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 235 6.51e-05 C.[KR][AS][FY] 3.31 9 8 8 0.19 1.51e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 236 6.66e-05 P..C..C.R 4.00 5 5 5 0.019 1.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 237 6.66e-05 C..CD..F 4.00 6 4 4 0.005 1.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 238 6.72e-05 C.[KR][AS]F.[HR] 4.31 5 5 5 0.009 2.59e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 239 6.83e-05 [FLM][KR].[HR][ST]..K 3.94 10 9 9 0.20 2.64e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 240 7.22e-05 HT..RP..C 5.00 4 4 4 0.002 2.79e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 241 7.30e-05 P.QC..C 4.00 7 5 5 0.020 1.69e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 242 7.43e-05 C..C..RF 4.00 6 4 4 0.005 1.72e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 243 7.50e-05 L..H.{0,1}R.{1,2}H..E 5.00 8 6 6 0.027 2.89e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 244 7.61e-05 H[KR]..YC 3.77 5 5 5 0.020 1.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 245 8.09e-05 P[IL]D.[ST] 3.54 13 13 13 1.13 1.87e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 246 8.22e-05 R.HT.E.P 5.00 5 5 5 0.009 3.17e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 247 8.26e-05 L..H.R..[ST].E 4.77 8 6 6 0.027 3.19e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 248 8.44e-05 [FHY].C..C 2.63 22 8 8 0.34 1.17e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 249 8.45e-05 [HK]..HL..H.R 4.77 5 5 5 0.009 3.26e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 250 8.56e-05 [ILM]DL[GS] 3.40 16 14 14 1.43 1.98e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 251 8.69e-05 P..C..C.{0,1}K.{1,2}F 5.00 9 4 4 0.002 3.35e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 252 9.10e-05 GE.P..C..C 5.00 6 4 4 0.002 3.51e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 252 9.10e-05 E.P..C..CG 5.00 4 4 4 0.002 3.51e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 254 9.11e-05 RI..IW.R 5.00 3 3 3 1.33e-04 3.52e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 255 9.21e-05 Y.C..C.{1,2}R.{0,1}S 5.00 6 4 4 0.002 3.55e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 256 9.67e-05 R.H.G.KP 5.00 7 5 5 0.009 3.73e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 257 9.69e-05 H..E.P..C 4.00 8 6 6 0.055 2.24e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 258 9.83e-05 PLDL 4.00 10 10 10 0.48 2.28e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 259 1.02e-04 K.H.RIH 5.00 4 4 4 0.002 3.92e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 260 1.09e-04 H[ST].E[KR]P 4.54 9 7 7 0.065 4.19e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 261 1.10e-04 Y..H..H.Y..C 5.00 3 3 3 1.41e-04 4.23e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 262 1.21e-04 P..C..CD[KR] 4.77 4 4 4 0.002 4.68e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 263 1.22e-04 H..H.Y.YC 5.00 3 3 3 1.47e-04 4.72e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 264 1.23e-04 P.[DE]L[ST] 3.54 19 16 16 2.19 2.86e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 265 1.25e-04 C..CG..F 4.00 4 4 4 0.005 2.88e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 266 1.26e-04 K.Y.C..C 4.00 6 4 4 0.005 2.91e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 267 1.26e-04 [HK].GRI..[IV] 4.54 5 5 5 0.010 4.86e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 268 1.27e-04 [KR].F.[HR]..HL 4.54 5 5 5 0.010 4.89e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 269 1.28e-04 G.I..IW.R 5.00 3 3 3 1.49e-04 4.94e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 270 1.35e-04 Y..H.N..Y..C 5.00 3 3 3 1.52e-04 5.23e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 271 1.37e-04 [HR]H[FIL][KR].H 4.17 6 6 6 0.030 5.30e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 272 1.38e-04 HM.H.Y..C 5.00 3 3 3 1.52e-04 5.31e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 273 1.38e-04 [HY].Q[FH][LM].[HK] 4.07 6 6 6 0.030 5.32e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 274 1.38e-04 GRI..IW 5.00 3 3 3 1.53e-04 5.33e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 275 1.47e-04 C..[AS]..[HR]..HL 4.54 5 5 5 0.010 5.67e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 276 1.47e-04 P[IL]DL..[KR] 4.54 7 7 7 0.068 5.67e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 277 1.47e-04 A..I..IW.R 5.00 3 3 3 1.56e-04 5.68e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 278 1.48e-04 H.N..Y.YC 5.00 3 3 3 1.56e-04 5.72e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 279 1.52e-04 K.H.R.H[ST] 4.77 5 5 5 0.010 5.86e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 280 1.57e-04 RP..C..C.{0,1}K 5.00 5 4 4 0.002 6.05e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 281 1.58e-04 A.RI..IW 5.00 3 3 3 1.60e-04 6.09e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 282 1.58e-04 NH.Y.YC 5.00 3 3 3 1.60e-04 6.09e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 283 1.59e-04 K.{1,2}QC.{1,2}C 4.00 6 6 6 0.060 3.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 284 1.70e-04 I..IW.R.Q 5.00 3 3 3 1.64e-04 6.57e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 285 1.71e-04 H..R.Q.IW 5.00 3 3 3 1.64e-04 6.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 286 1.72e-04 H..RIQ..W 5.00 3 3 3 1.64e-04 6.63e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 287 1.75e-04 HMN..Y..C 5.00 3 3 3 1.65e-04 6.75e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 288 1.77e-04 [HR]H.[KR].H 3.54 9 8 8 0.22 4.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 289 1.79e-04 P[ILMV].[LV][ST] 3.07 30 21 21 4.79 4.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 290 1.80e-04 MNH.Y..C 5.00 3 3 3 1.67e-04 6.93e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 291 1.81e-04 IQ.IW.R 5.00 3 3 3 1.67e-04 7.00e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 292 1.83e-04 C..C.RS 4.00 5 5 5 0.024 4.24e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 293 1.86e-04 K..H.{0,1}L..H.R 5.00 5 5 5 0.010 7.18e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 294 1.89e-04 RIQ.IW 5.00 3 3 3 1.69e-04 7.28e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 295 1.89e-04 C..C.{0,1}K.{1,2}F 4.00 13 5 5 0.024 4.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 296 1.93e-04 [DE].P.DL..[KR] 4.54 7 7 7 0.070 7.45e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 297 1.94e-04 P..C..CG 4.00 8 5 5 0.024 4.50e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 298 1.97e-04 K.{1,2}HL..H.R 5.00 5 5 5 0.011 7.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 299 1.97e-04 KP..C..C..S 5.00 4 4 4 0.002 7.58e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 300 1.98e-04 [ST].E..[FY].C..C 4.54 6 4 4 0.002 7.65e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 301 2.04e-04 GRI..[IV].S 4.77 5 5 5 0.011 7.85e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 302 2.11e-04 Y.C..C.{0,1}K.{0,2}K 5.00 4 4 4 0.002 8.13e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 303 2.12e-04 Q[HK][MV]..R.S 4.54 6 6 6 0.032 8.19e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 304 2.14e-04 KA[FH].[HR].H 4.54 5 5 5 0.011 8.25e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 305 2.17e-04 C..CD[KR] 3.77 5 5 5 0.025 5.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 306 2.25e-04 L..H.R[IL]H 4.77 7 5 5 0.011 8.69e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 307 2.31e-04 D.PL.L[ST] 4.77 8 7 7 0.072 8.92e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 308 2.35e-04 EH.RIH 5.00 4 4 4 0.002 9.06e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 309 2.39e-04 I..IW.R..E 5.00 3 3 3 1.83e-04 9.22e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 310 2.39e-04 AG.I..IW 5.00 3 3 3 1.83e-04 9.23e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 311 2.48e-04 [HY].C..C..[AS].K 4.54 4 4 4 0.002 9.57e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 312 2.53e-04 C.IC.K.F 5.00 3 3 3 1.87e-04 9.75e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 313 2.53e-04 R.H..EKP 5.00 7 5 5 0.011 9.76e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 314 2.55e-04 H.G.IQ..W 5.00 3 3 3 1.87e-04 9.83e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 314 2.55e-04 H.G..Q.IW 5.00 3 3 3 1.87e-04 9.83e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 316 2.56e-04 G.IQ.IW 5.00 3 3 3 1.88e-04 9.88e-13 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 317 2.68e-04 R.H.G..P..C 5.00 6 4 4 0.002 1.03e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 318 2.70e-04 E.P[FY].C 3.77 8 6 6 0.066 6.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 319 2.79e-04 GRI..[IV]..[KR] 4.54 5 5 5 0.011 1.08e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 320 2.81e-04 HM..RY..C 5.00 3 3 3 1.93e-04 1.08e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 320 2.81e-04 HM..R..YC 5.00 3 3 3 1.93e-04 1.08e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 322 2.87e-04 Q.M.H.Y..C 5.00 3 3 3 1.95e-04 1.11e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 323 2.89e-04 M.HRY..C 5.00 3 3 3 1.95e-04 1.12e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 323 2.89e-04 M.HR..YC 5.00 3 3 3 1.95e-04 1.12e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 325 2.99e-04 C..C..AF.H 5.00 3 3 3 1.97e-04 1.15e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 326 3.00e-04 HRY.YC 5.00 3 3 3 1.98e-04 1.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 327 3.03e-04 H.R.H.G 4.00 8 6 6 0.067 7.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 328 3.04e-04 [HR].[KR].[HK]..E[KR] 4.07 10 8 8 0.14 1.17e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 329 3.07e-04 H[FLM]R..[ST]..K 4.40 7 6 6 0.034 1.18e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 330 3.10e-04 HA..IQ..W 5.00 3 3 3 2.00e-04 1.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 331 3.17e-04 [KR]..QC..C 3.77 7 5 5 0.026 7.34e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 332 3.17e-04 L..H.{1,2}R.{0,1}H 4.00 13 9 9 0.37 7.35e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 333 3.23e-04 H.C..C.K.F 5.00 3 3 3 2.03e-04 1.25e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 333 3.23e-04 C..C.K.F.H 5.00 8 3 3 2.03e-04 1.25e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 335 3.24e-04 L..H[KR]..H.G 4.77 6 5 5 0.012 1.25e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 336 3.24e-04 [FLM]R.H[ST]..K 4.40 7 6 6 0.034 1.25e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 337 3.28e-04 L..H.RIH 5.00 4 4 4 0.002 1.26e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 338 3.30e-04 A..IQ.IW 5.00 3 3 3 2.04e-04 1.27e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 339 3.32e-04 CG[KR].[FY] 3.54 6 6 6 0.068 7.69e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 340 3.33e-04 Y..H..H.Y.Y 5.00 3 3 3 2.05e-04 1.28e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 341 3.41e-04 H.K.H.R.H 5.00 4 4 4 0.003 1.31e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 342 3.41e-04 F..R.T..E.N 5.00 4 4 4 0.003 1.32e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 343 3.45e-04 P..C..CG.{0,1}R 5.00 4 4 4 0.003 1.33e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 344 3.56e-04 [IV]K.[DE]P 3.54 12 11 11 0.75 8.25e-11 2 19 19
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 345 3.69e-04 N.RY.YC 5.00 3 3 3 2.12e-04 1.42e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 346 3.74e-04 H..H..R.Q..W 5.00 3 3 3 2.13e-04 1.44e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 347 3.81e-04 H.G..P[HY].C 4.77 8 4 4 0.003 1.47e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 348 3.81e-04 QC.{1,2}CG 4.00 5 5 5 0.027 8.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 349 3.90e-04 Y..H.N..Y.Y 5.00 3 3 3 2.16e-04 1.50e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 350 3.90e-04 RI..IW..L 5.00 3 3 3 2.16e-04 1.50e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 351 3.91e-04 H[ST]GE.P 4.77 8 6 6 0.035 1.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 352 3.95e-04 L..H..[ILM]H 3.63 12 8 8 0.24 9.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 353 3.96e-04 Y..HM.H.Y 5.00 3 3 3 2.17e-04 1.53e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 354 4.01e-04 I..IW.RL 5.00 3 3 3 2.18e-04 1.55e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 355 4.08e-04 HM.H.Y.Y 5.00 3 3 3 2.19e-04 1.58e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 356 4.09e-04 R.{1,2}H..E.P 4.00 14 9 9 0.38 9.47e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 357 4.12e-04 A..S..V[HK]..L 4.77 6 6 6 0.036 1.59e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 358 4.13e-04 QPL.L..K 5.00 6 6 6 0.036 1.60e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 359 4.14e-04 Y.Q..N..Y..C 5.00 3 3 3 2.20e-04 1.60e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 360 4.15e-04 MN.R..YC 5.00 3 3 3 2.20e-04 1.60e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 360 4.15e-04 MN.RY..C 5.00 3 3 3 2.20e-04 1.60e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 362 4.37e-04 H[KR]..H.G..P 4.77 6 5 5 0.012 1.69e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 363 4.39e-04 Q..N..Y.YC 5.00 3 3 3 2.25e-04 1.70e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 364 4.40e-04 TRH.R.H 5.00 4 4 4 0.003 1.70e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 365 4.42e-04 C.[KR][AS][FY]K 4.31 5 5 5 0.012 1.71e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 366 4.63e-04 P[IL].L[ST].[KR] 4.31 9 9 9 0.24 1.79e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 367 4.66e-04 [HR][HK][FILM]..H 3.07 15 11 11 0.77 1.08e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 368 4.70e-04 Y..HMN..Y 5.00 3 3 3 2.30e-04 1.81e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 369 4.82e-04 HMN..Y.Y 5.00 3 3 3 2.32e-04 1.86e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 370 4.86e-04 D.P.DL 4.00 8 8 8 0.25 1.13e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 371 4.95e-04 MNH.Y.Y 5.00 3 3 3 2.34e-04 1.91e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 372 5.13e-04 T..RP[FH].C 4.77 4 4 4 0.003 1.98e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 373 5.18e-04 H..E..Y.C..C 5.00 6 3 3 2.37e-04 2.00e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 374 5.28e-04 LK.[HR]..[IL][HK] 4.31 7 7 7 0.081 2.04e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 375 5.31e-04 Q.MN..Y..C 5.00 3 3 3 2.39e-04 2.05e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 376 5.54e-04 H[LM]R.HS 4.77 6 5 5 0.013 2.14e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 377 5.60e-04 H..H.G..Q..W 5.00 3 3 3 2.43e-04 2.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 378 5.60e-04 G.I..IW..L 5.00 3 3 3 2.43e-04 2.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 379 5.62e-04 H.Y.YCK 5.00 3 3 3 2.44e-04 2.17e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 380 5.67e-04 P[IL]D.S 3.77 11 11 11 0.79 1.31e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 381 5.67e-04 M.H.Y..CK 5.00 3 3 3 2.44e-04 2.19e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 382 6.34e-04 Y.C.NC.K 5.00 3 3 3 2.54e-04 2.45e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 382 6.34e-04 K.Y.C.NC 5.00 3 3 3 2.54e-04 2.45e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 384 6.42e-04 H..E.P.QC 5.00 4 4 4 0.003 2.48e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 385 6.45e-04 H.RIH 4.00 5 5 5 0.030 1.49e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 386 6.61e-04 H..E..F.C..C 5.00 3 3 3 2.57e-04 2.55e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 387 6.62e-04 A..I..IW..L 5.00 3 3 3 2.57e-04 2.55e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 388 6.81e-04 R.Y.C..C.K 5.00 3 3 3 2.60e-04 2.63e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 389 6.86e-04 S.L.R[HR]K 4.77 6 6 6 0.039 2.65e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 390 6.92e-04 H.GEKP 5.00 7 5 5 0.014 2.67e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 391 7.15e-04 [DE].P[ILMV].L 3.31 18 16 16 2.46 1.66e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 392 7.29e-04 P..A..I..IW 5.00 3 3 3 2.66e-04 2.81e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 393 7.33e-04 C.[KR][AS]..[HR]..H 4.31 5 5 5 0.014 2.83e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 394 7.35e-04 H.NH.Y..C 5.00 3 3 3 2.67e-04 2.84e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 395 7.35e-04 LK.H..IH 5.00 4 4 4 0.003 2.84e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 396 7.41e-04 Q.M..RY..C 5.00 3 3 3 2.67e-04 2.86e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 396 7.41e-04 Q.M..R..YC 5.00 3 3 3 2.67e-04 2.86e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 398 7.49e-04 KA[FH][KR]..H 4.54 5 5 5 0.014 2.89e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 399 7.59e-04 Y..HM..R..Y 5.00 3 3 3 2.69e-04 2.93e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 400 7.77e-04 Y.C..CDK 5.00 3 3 3 2.72e-04 3.00e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 401 7.78e-04 P.DL..[KR] 3.77 10 10 10 0.59 1.80e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 402 7.98e-04 I..IW..LQ 5.00 3 3 3 2.74e-04 3.08e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 403 8.03e-04 R.F.C..CG 5.00 3 3 3 2.75e-04 3.10e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 404 8.09e-04 [DE].P.[DE]L 3.54 16 14 14 1.70 1.87e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 405 8.09e-04 Y..HM..RY 5.00 3 3 3 2.75e-04 3.12e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 406 8.14e-04 Y.C..C.{1,2}R 4.00 6 4 4 0.009 1.88e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 407 8.18e-04 [ST]..[KR].[FY].C..C 4.31 6 4 4 0.003 3.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 408 8.19e-04 IQ.IW..L 5.00 3 3 3 2.76e-04 3.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 409 8.28e-04 HL..H.R..[ST] 4.77 7 5 5 0.014 3.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 410 8.29e-04 H..E[KR].[FY].C 4.54 6 4 4 0.003 3.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 411 8.32e-04 I.SIW.R 5.00 3 3 3 2.78e-04 3.21e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 412 8.33e-04 C.NC.K.F 5.00 3 3 3 2.78e-04 3.21e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 413 8.33e-04 HM..RY.Y 5.00 3 3 3 2.78e-04 3.22e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 414 8.33e-04 Y.Q.M.H.Y 5.00 3 3 3 2.78e-04 3.22e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 414 8.33e-04 Q.M.H.Y.Y 5.00 3 3 3 2.78e-04 3.22e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 416 8.40e-04 I..IWSR 5.00 3 3 3 2.79e-04 3.24e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 416 8.40e-04 RI..IWS 5.00 3 3 3 2.79e-04 3.24e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 418 8.58e-04 M.HRY.Y 5.00 3 3 3 2.81e-04 3.31e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 419 8.63e-04 RI.SIW 5.00 3 3 3 2.81e-04 3.33e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 420 8.78e-04 R.Q.IW.R 5.00 3 3 3 2.83e-04 3.39e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 421 8.84e-04 RIQ..W.R 5.00 3 3 3 2.84e-04 3.41e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 422 9.02e-04 Y.C.N..K.F 5.00 3 3 3 2.85e-04 3.48e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 423 9.30e-04 H..RI.S.W 5.00 3 3 3 2.88e-04 3.59e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 424 9.35e-04 YQC..C.K 5.00 3 3 3 2.89e-04 3.61e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 425 9.37e-04 H..R..SIW 5.00 3 3 3 2.89e-04 3.62e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 426 9.80e-04 K.{1,2}QC.{1,2}CG 5.00 4 4 4 0.003 3.78e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 427 9.81e-04 S.L..[HK]..E[HR] 4.54 7 7 7 0.089 3.79e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 428 9.85e-04 Y.C..C..S 4.00 4 4 4 0.009 2.28e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 429 0.001 CD.C.K.F 5.00 4 3 3 2.96e-04 3.90e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 430 0.001 C..C..S 3.00 8 8 8 0.47 1.41e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 431 0.001 H.RIHS 5.00 4 4 4 0.003 3.95e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 432 0.001 H[LM]..HS..K 4.77 6 5 5 0.015 4.00e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 433 0.001 [ST]G..P..C..C 4.77 9 4 4 0.003 4.01e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 434 0.001 L..L.{1,2}N..K.K 5.00 6 6 6 0.042 4.07e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 435 0.001 RI..[IV]..[KR]..E 4.54 5 5 5 0.015 4.11e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 436 0.001 H.{0,1}R.{1,2}H.G.K 5.00 7 5 5 0.015 4.11e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 437 0.001 A..S..V..[KR]L 4.77 6 6 6 0.042 4.14e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 438 0.001 HL..H.{0,1}R.{1,2}H 5.00 9 5 5 0.015 4.14e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 438 0.001 HL..H.{1,2}R.{0,1}H 5.00 9 5 5 0.015 4.14e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 440 0.001 C.NC..R..H 5.00 3 3 3 3.04e-04 4.19e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 441 0.001 Y..D.C.K.F 5.00 4 3 3 3.04e-04 4.21e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 442 0.001 R.T..E.N..[LV] 4.77 5 5 5 0.015 4.21e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 443 0.001 I..IW..L.E 5.00 3 3 3 3.05e-04 4.23e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 444 0.001 N..Y.YCK 5.00 3 3 3 3.05e-04 4.24e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 445 0.001 H.GE.P..C 5.00 6 4 4 0.003 4.49e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 446 0.001 MN..Y..CK 5.00 3 3 3 3.11e-04 4.50e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 447 0.001 Y.Q..N..Y.Y 5.00 3 3 3 3.11e-04 4.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 448 0.001 YEC.NC 5.00 3 3 3 3.12e-04 4.54e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 449 0.001 MN.RY.Y 5.00 3 3 3 3.13e-04 4.61e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 450 0.001 R.H..E..[FY] 3.77 8 6 6 0.085 2.77e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 451 0.001 RP[FHY].C 3.63 6 6 6 0.085 2.80e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 452 0.001 QP[LV].[LV] 3.54 13 13 13 1.41 2.81e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 453 0.001 C..C..AF..K 5.00 3 3 3 3.15e-04 4.70e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 454 0.001 K.Y.C..CG 5.00 3 3 3 3.17e-04 4.78e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 455 0.001 C..C..A..H..H 5.00 3 3 3 3.18e-04 4.80e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 456 0.001 H[HK]L..H..L 4.77 5 5 5 0.015 4.83e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 457 0.001 G.I..IWS 5.00 3 3 3 3.18e-04 4.83e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 458 0.001 E.P[FY]QC 4.77 4 4 4 0.003 4.84e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 459 0.001 [AS]F.[HR]..HL 4.54 5 5 5 0.015 4.88e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 460 0.001 G.IQ..W.R 5.00 3 3 3 3.20e-04 4.90e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 460 0.001 G..Q.IW.R 5.00 3 3 3 3.20e-04 4.90e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 460 0.001 IW.R.Q..G 5.00 3 3 3 3.20e-04 4.90e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 463 0.001 P.DL[ST]..[KR] 4.54 7 7 7 0.092 4.92e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 464 0.001 S..R..Y.H.G 5.00 4 4 4 0.003 4.96e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 465 0.001 G.I.SIW 5.00 3 3 3 3.21e-04 4.97e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 466 0.001 C..C..A..H.H 5.00 3 3 3 3.21e-04 4.98e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 467 0.001 C..C..AFK 5.00 3 3 3 3.22e-04 5.02e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 468 0.001 H..[IL][HY] 2.54 22 16 16 3.39 1.83e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 469 0.001 [FY].C.QC 3.77 5 4 4 0.010 3.08e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 470 0.001 C..C.KAF 5.00 4 3 3 3.25e-04 5.16e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 471 0.001 [FY]QC..C 3.77 5 4 4 0.010 3.11e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 472 0.001 R..[ST].E[KR]P 4.54 9 7 7 0.093 5.25e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 473 0.001 GR.Q.IW 5.00 3 3 3 3.28e-04 5.27e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 474 0.001 GRIQ..W 5.00 3 3 3 3.28e-04 5.29e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 475 0.001 QH..H.Y..C 5.00 3 3 3 3.28e-04 5.31e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 476 0.001 M..RY..CK 5.00 3 3 3 3.29e-04 5.32e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 476 0.001 M..R..YCK 5.00 3 3 3 3.29e-04 5.32e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 478 0.001 QC..C.K.F 5.00 4 3 3 3.29e-04 5.36e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 479 0.001 A..I..IWS 5.00 3 3 3 3.30e-04 5.36e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 480 0.001 H.R..[ST]G.K 4.77 7 5 5 0.016 5.42e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 481 0.001 R.{1,2}H.GEK 5.00 9 5 5 0.016 5.42e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 482 0.001 H.R..S..KP 5.00 8 5 5 0.016 5.45e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 483 0.001 A..I.SIW 5.00 3 3 3 3.33e-04 5.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 484 0.001 H..HR..YC 5.00 3 3 3 3.33e-04 5.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 484 0.001 H..HRY..C 5.00 3 3 3 3.33e-04 5.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 486 0.001 H..R.Q..W.R 5.00 3 3 3 3.33e-04 5.52e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 487 0.001 H[KR]..H.G.[KR] 4.54 5 5 5 0.016 5.52e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 488 0.001 RY.YCK 5.00 3 3 3 3.34e-04 5.60e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 489 0.001 H.G.I.S.W 5.00 3 3 3 3.36e-04 5.66e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 490 0.001 YC.{1,2}R 3.00 9 8 8 0.49 2.04e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 491 0.001 Y.Q.MN..Y 5.00 3 3 3 3.36e-04 5.69e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 491 0.001 Q.MN..Y.Y 5.00 3 3 3 3.36e-04 5.69e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 493 0.001 A..IQ..W.R 5.00 3 3 3 3.37e-04 5.72e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 494 0.002 F..R.T.S..N 5.00 4 4 4 0.004 5.84e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 495 0.002 E..Y.CD.C 5.00 3 3 3 3.41e-04 5.93e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 496 0.002 I..IWS..Q 5.00 3 3 3 3.43e-04 6.04e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 497 0.002 R.H[ST]G.K 4.77 7 5 5 0.016 6.05e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 498 0.002 C.{0,1}D.{0,1}C.{1,2}R.{0,1}F 5.00 4 4 4 0.004 6.06e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 499 0.002 R.HS..KP 5.00 8 5 5 0.016 6.07e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 500 0.002 A.R.Q.IW 5.00 3 3 3 3.44e-04 6.10e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 501 0.002 A.RIQ..W 5.00 3 3 3 3.45e-04 6.15e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 502 0.002 H.N.RY..C 5.00 3 3 3 3.46e-04 6.19e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 502 0.002 H.N.R..YC 5.00 3 3 3 3.46e-04 6.19e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 504 0.002 C..C..[AS] 2.77 13 9 9 0.72 2.26e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 505 0.002 Q.{0,2}P.DLS 5.00 8 7 7 0.096 6.32e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 506 0.002 K.H.R.H.G 5.00 4 4 4 0.004 6.33e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 507 0.002 PY.C..CD 5.00 3 3 3 3.49e-04 6.38e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 508 0.002 IQ..W.R.Q 5.00 3 3 3 3.51e-04 6.47e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 509 0.002 HA..I.S.W 5.00 3 3 3 3.52e-04 6.53e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 510 0.002 IQ.IWS 5.00 3 3 3 3.53e-04 6.59e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 511 0.002 NHRY..C 5.00 3 3 3 3.54e-04 6.62e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 511 0.002 NHR..YC 5.00 3 3 3 3.54e-04 6.62e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 513 0.002 PY.CD.C 5.00 3 3 3 3.54e-04 6.62e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 514 0.002 Q.IW.R.Q 5.00 3 3 3 3.54e-04 6.67e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 515 0.002 H.{1,2}RI.S 4.00 7 7 7 0.17 4.01e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 516 0.002 I.S..KP..C 5.00 4 4 4 0.004 6.73e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 517 0.002 IQSIW 5.00 3 3 3 3.57e-04 6.84e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 518 0.002 H.R.HT.E 5.00 4 4 4 0.004 6.92e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 519 0.002 Q..P.DL 4.00 8 8 8 0.30 4.19e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 520 0.002 [FL]..R.R..Q.[MV] 4.54 5 5 5 0.016 6.98e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 521 0.002 M.H.Y.Y.K 5.00 3 3 3 3.60e-04 7.01e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 522 0.002 Y..H.NH.Y 5.00 3 3 3 3.62e-04 7.09e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 523 0.002 [AG][GS]..Q.[IM]..R 4.31 7 6 6 0.046 7.12e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 524 0.002 K.H..IH 4.00 5 5 5 0.038 4.29e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 525 0.002 CD.C..R..H 5.00 3 3 3 3.64e-04 7.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 526 0.002 H.NH.Y.Y 5.00 3 3 3 3.65e-04 7.30e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 527 0.002 K.Y.C..C.K 5.00 5 3 3 3.68e-04 7.44e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 528 0.002 PYQC..C 5.00 3 3 3 3.68e-04 7.47e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 529 0.002 G.I..[IV]..[KR]..E 4.54 5 5 5 0.017 7.56e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 529 0.002 I..[IV]..[KR]..E.G 4.54 5 5 5 0.017 7.56e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 531 0.002 K.[HR].R.[HKR] 3.40 11 10 10 0.65 4.55e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 532 0.002 G.{1,2}Y.C..C 4.00 4 4 4 0.011 4.61e-10 3 4 4
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 533 0.002 P..C.YC.R 5.00 3 3 3 3.73e-04 7.75e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 534 0.002 P..C..CD..F 5.00 3 3 3 3.74e-04 7.82e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 535 0.002 IW.R..E.G 5.00 3 3 3 3.74e-04 7.86e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 536 0.002 R.R..Q..[AG].R 4.77 5 5 5 0.017 7.87e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 537 0.002 QH.N..Y..C 5.00 3 3 3 3.75e-04 7.88e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 537 0.002 Q..NH.Y..C 5.00 3 3 3 3.75e-04 7.88e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 539 0.002 IQ..W.R..E 5.00 3 3 3 3.78e-04 8.07e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 540 0.002 F..RKT..E 5.00 4 4 4 0.004 8.12e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 541 0.002 [FY].C..CG 3.77 6 4 4 0.011 4.93e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 542 0.002 Q.IW.R..E 5.00 3 3 3 3.81e-04 8.31e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 543 0.002 QC..C..R..H 5.00 3 3 3 3.84e-04 8.46e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 544 0.002 H.G..Q..W.R 5.00 3 3 3 3.84e-04 8.47e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 545 0.002 H..H..R..S.W 5.00 3 3 3 3.86e-04 8.61e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 546 0.002 Y.Q.M..R..Y 5.00 3 3 3 3.87e-04 8.66e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 547 0.002 GRI.{1,2}I.{1,2}S 5.00 5 5 5 0.017 8.81e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 548 0.002 IW.R.QE 5.00 3 3 3 3.90e-04 8.88e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 549 0.002 [ST]..[KR]..QC..C 4.54 5 4 4 0.004 9.09e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 550 0.002 H..IHS..K 5.00 4 4 4 0.004 9.11e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 551 0.002 H.GR.Q..W 5.00 3 3 3 3.94e-04 9.17e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 552 0.002 Q.M..RY.Y 5.00 3 3 3 3.95e-04 9.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 552 0.002 Y.Q.M..RY 5.00 3 3 3 3.95e-04 9.20e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 554 0.002 Y..HMNH 5.00 3 3 3 3.96e-04 9.27e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 555 0.002 H..H.Y..CK 5.00 3 3 3 3.97e-04 9.36e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 556 0.002 AG.IQ..W 5.00 3 3 3 3.99e-04 9.49e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 556 0.002 AG..Q.IW 5.00 3 3 3 3.99e-04 9.49e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 558 0.002 HMNH.Y 5.00 3 3 3 3.99e-04 9.51e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 559 0.002 P..C..C.R.F 5.00 3 3 3 3.99e-04 9.53e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 560 0.002 K.H.R..[ST]..K 4.77 5 5 5 0.018 9.62e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 561 0.003 R.{1,2}HT.E.P 5.00 7 5 5 0.018 9.77e-12 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 562 0.003 [KR]P[FY].C 3.54 9 6 6 0.097 6.06e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 563 0.003 C..C.K.F..K 5.00 3 3 3 4.08e-04 1.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 564 0.003 FP.RKT 5.00 4 4 4 0.004 1.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 565 0.003 R..Q.[MV]..R[KR] 4.54 5 5 5 0.018 1.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 566 0.003 HA.R.Q..W 5.00 3 3 3 4.13e-04 1.06e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 567 0.003 C..C.K.FK 5.00 3 3 3 4.15e-04 1.07e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 568 0.003 GE..Y.C..C 5.00 5 3 3 4.16e-04 1.07e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 569 0.003 S..M.H.Y..C 5.00 3 3 3 4.18e-04 1.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 570 0.003 [HK]..RI..[IV].S 4.54 5 5 5 0.018 1.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 571 0.003 H.YSYC 5.00 3 3 3 4.19e-04 1.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 572 0.003 F.LRKT 5.00 4 4 4 0.004 1.12e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 573 0.003 H..E.P..C.{0,1}N 5.00 4 4 4 0.004 1.13e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 574 0.003 V..R.{1,2}SP 4.00 10 10 10 0.68 6.84e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 575 0.003 C.K.F.H..H 5.00 3 3 3 4.24e-04 1.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 576 0.003 H[ST].E..[FY].C 4.54 6 4 4 0.004 1.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 577 0.003 R.{1,2}H.G.KP 5.00 9 5 5 0.018 1.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 578 0.003 F.L..T..E.N 5.00 4 4 4 0.004 1.16e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 579 0.003 C.K.F.H.H 5.00 3 3 3 4.28e-04 1.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 580 0.003 [IL]DLS.K 4.77 6 6 6 0.050 1.19e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 581 0.003 KPY.C..C 5.00 5 3 3 4.30e-04 1.19e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 582 0.003 E..Y.C..C.K 5.00 5 3 3 4.30e-04 1.19e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 583 0.003 M.H.YS.C 5.00 3 3 3 4.31e-04 1.20e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 584 0.003 C..AF.H..H 5.00 3 3 3 4.31e-04 1.20e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 585 0.003 M.H..SYC 5.00 3 3 3 4.33e-04 1.21e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 586 0.003 P.DL..K 4.00 8 8 8 0.32 7.32e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 587 0.003 C..AF.H.H 5.00 3 3 3 4.37e-04 1.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 588 0.003 R.H.C..C.K 5.00 3 3 3 4.41e-04 1.29e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 589 0.003 C.{1,2}CG 3.00 12 8 8 0.54 4.65e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 590 0.003 C..C.KR..H 5.00 6 3 3 4.42e-04 1.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 590 0.003 C.KC..R..H 5.00 3 3 3 4.42e-04 1.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 592 0.003 Y..H..HR..Y 5.00 3 3 3 4.45e-04 1.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 593 0.003 MN..Y.Y.K 5.00 3 3 3 4.45e-04 1.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 594 0.003 K.YEC..C 5.00 3 3 3 4.45e-04 1.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 594 0.003 YEC..C.K 5.00 3 3 3 4.45e-04 1.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 596 0.003 Y.[HK].G.[KR]P 4.54 5 5 5 0.019 1.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 597 0.003 K.{0,1}R.{0,1}R 3.00 28 23 23 8.62 4.82e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 598 0.004 Y.QH..H.Y 5.00 3 3 3 4.51e-04 1.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 598 0.004 QH..H.Y.Y 5.00 3 3 3 4.51e-04 1.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 600 0.004 C.[KR][AS]F 3.54 7 6 6 0.10 8.31e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 601 0.004 Y..H..HRY 5.00 3 3 3 4.55e-04 1.41e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 602 0.004 C..C..R..H.G 5.00 6 3 3 4.56e-04 1.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 603 0.004 Y..H.N.R..Y 5.00 3 3 3 4.56e-04 1.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 604 0.004 CP.C.K.F 5.00 3 3 3 4.58e-04 1.44e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 605 0.004 H..HRY.Y 5.00 3 3 3 4.60e-04 1.46e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 606 0.004 P..C..CG..F 5.00 3 3 3 4.61e-04 1.47e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 607 0.004 I..IWS.L 5.00 3 3 3 4.63e-04 1.48e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 607 0.004 I.SIW..L 5.00 3 3 3 4.63e-04 1.48e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 609 0.004 R.H..E..[FY]Q 4.77 4 4 4 0.005 1.50e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 610 0.004 Y..H.N.RY 5.00 3 3 3 4.65e-04 1.51e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 611 0.004 R.K.{1,2}K.A..R 5.00 5 5 5 0.019 1.51e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 612 0.004 H[ILM][KR].H 3.40 15 8 8 0.33 9.15e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 613 0.004 R.Q.IW..L 5.00 3 3 3 4.67e-04 1.53e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 614 0.004 C.YC.RS 5.00 3 3 3 4.68e-04 1.53e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 615 0.004 G.R.H.C..C 5.00 3 3 3 4.68e-04 1.53e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 616 0.004 C.NC.K 4.00 4 4 4 0.013 9.21e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 617 0.004 RIQ..W..L 5.00 3 3 3 4.68e-04 1.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 618 0.004 H.N.RY.Y 5.00 3 3 3 4.70e-04 1.55e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 619 0.004 H.{0,1}R.{1,2}H..EK 5.00 7 5 5 0.019 1.55e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 620 0.004 C..S[FY] 2.77 10 10 10 1.09 5.65e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 621 0.004 IQ..W.RL 5.00 3 3 3 4.73e-04 1.59e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 622 0.004 Q.IW.RL 5.00 3 3 3 4.79e-04 1.64e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 623 0.004 NHRY.Y 5.00 3 3 3 4.80e-04 1.66e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 624 0.004 L..H.[KR].H 3.77 14 7 7 0.20 9.96e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 625 0.004 H.N..Y..CK 5.00 3 3 3 4.81e-04 1.67e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 626 0.004 R.R..Q.[MV][AG] 4.54 5 5 5 0.020 1.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 626 0.004 R..Q.[MV][AG].R 4.54 5 5 5 0.020 1.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 628 0.004 H.{1,2}EH.G.{0,1}R 5.00 5 5 5 0.020 1.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 629 0.004 [HK]..RI..[IV]..[KR] 4.31 5 5 5 0.020 1.69e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 630 0.004 RI.S.W.R 5.00 3 3 3 4.83e-04 1.69e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 631 0.004 R..SIW.R 5.00 3 3 3 4.84e-04 1.70e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 632 0.004 HM.HR..Y 5.00 3 3 3 4.85e-04 1.70e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 632 0.004 Y..HM.HR 5.00 3 3 3 4.85e-04 1.70e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 634 0.004 IW.RLQ 5.00 3 3 3 4.85e-04 1.71e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 635 0.004 [KR].[HK].[AG]E[KR] 4.07 10 8 8 0.20 1.71e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 636 0.004 C..C..A.K..H 5.00 3 3 3 4.86e-04 1.72e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 637 0.004 N..YSYC 5.00 3 3 3 4.87e-04 1.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 638 0.004 P..C..C..AF 5.00 4 3 3 4.87e-04 1.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 639 0.004 E.P..C.{0,1}N.{0,1}C 5.00 4 4 4 0.005 1.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 640 0.004 HAG..Q..W 5.00 3 3 3 4.88e-04 1.74e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 641 0.004 C..CD..F..S 5.00 3 3 3 4.88e-04 1.74e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 642 0.005 K.H.R.H..E 5.00 4 4 4 0.005 1.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 643 0.005 PY.C..CG 5.00 3 3 3 4.89e-04 1.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 644 0.005 EC..C.K.F 5.00 4 3 3 4.90e-04 1.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 645 0.005 D..[IL]DL 3.77 9 8 8 0.33 1.06e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 646 0.005 NH.Y..CK 5.00 3 3 3 4.90e-04 1.77e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 647 0.005 C..[AS][FY]K 3.54 6 6 6 0.11 1.07e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 648 0.005 C..C..A..HK 5.00 3 3 3 4.93e-04 1.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 649 0.005 F..RK..S..N 5.00 4 4 4 0.005 1.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 650 0.005 Y.{0,1}YC 3.00 6 6 6 0.21 6.48e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 651 0.005 R..[ST]GE.P 4.77 8 6 6 0.053 1.80e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 652 0.005 M..RY.Y.K 5.00 3 3 3 4.94e-04 1.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 653 0.005 HM.HRY 5.00 3 3 3 4.96e-04 1.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 654 0.005 S..MN..Y..C 5.00 3 3 3 4.97e-04 1.84e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 655 0.005 C..C.KA..H 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 655 0.005 C..C..A.KH 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 657 0.005 Y.QH.N..Y 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 657 0.005 QH.N..Y.Y 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 657 0.005 Q..NH.Y.Y 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 657 0.005 Y.Q..NH.Y 5.00 3 3 3 4.98e-04 1.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 661 0.005 Y..HMN.R 5.00 3 3 3 5.00e-04 1.87e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 661 0.005 HMN.R..Y 5.00 3 3 3 5.00e-04 1.87e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 663 0.005 C..C.R.F..S 5.00 3 3 3 5.00e-04 1.87e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 664 0.005 CD.C.K 4.00 6 4 4 0.014 1.14e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 665 0.005 KT.S.PN 5.00 5 5 5 0.020 1.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 666 0.005 F..R.T..E..L 5.00 4 4 4 0.005 1.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 667 0.005 A[IV].S..VK 4.77 5 5 5 0.020 1.92e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 668 0.005 [KR][AS]F.[HR]..H 4.31 5 5 5 0.020 1.92e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 669 0.005 EH..IHS 5.00 4 4 4 0.005 1.93e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 670 0.005 H[HK]L..H..[IL] 4.54 7 5 5 0.020 1.93e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 671 0.005 [LM][KR].[HR]S..K 4.31 8 7 7 0.11 1.93e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 672 0.005 MNHR..Y 5.00 3 3 3 5.06e-04 1.94e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 673 0.005 Y.QHM.H 5.00 3 3 3 5.08e-04 1.96e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 673 0.005 QHM.H.Y 5.00 3 3 3 5.08e-04 1.96e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 675 0.005 HMN.RY 5.00 3 3 3 5.10e-04 1.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 676 0.005 Y.C.NC.{0,1}K 5.00 3 3 3 5.10e-04 1.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 677 0.005 MN..YS.C 5.00 3 3 3 5.11e-04 1.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 678 0.005 [FM]..RK.[AG]..P 4.54 5 5 5 0.020 2.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 679 0.005 R.H[ST].E 3.77 10 8 8 0.34 1.20e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 680 0.005 [IV]K.E..[DE] 3.54 12 10 10 0.72 1.21e-09 2 19 19
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 681 0.005 C..C..RFS 5.00 5 3 3 5.13e-04 2.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 682 0.005 H.R..[ST].EK 4.77 7 5 5 0.020 2.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 683 0.005 G..S.H..H.{0,2}R 5.00 5 5 5 0.020 2.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 684 0.005 C.[KR].F..S..L 4.77 5 4 4 0.005 2.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 685 0.005 MNHRY 5.00 3 3 3 5.16e-04 2.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 686 0.005 H.{1,2}K.H.R.H 5.00 6 4 4 0.005 2.06e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 687 0.005 C..CD 3.00 8 6 6 0.22 7.51e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 688 0.005 C..C.RSF 5.00 3 3 3 5.18e-04 2.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 689 0.005 Q..N.RY..C 5.00 3 3 3 5.19e-04 2.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 689 0.005 Q..N.R..YC 5.00 3 3 3 5.19e-04 2.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 691 0.005 F..R.T..EP 5.00 4 4 4 0.005 2.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 692 0.005 L.E..RIH 5.00 4 4 4 0.005 2.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 693 0.005 C.[KR].[FY] 2.54 21 10 10 1.12 7.65e-08 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 694 0.006 IW.R..E..L 5.00 3 3 3 5.23e-04 2.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 695 0.006 L.{0,1}E.{0,1}H.{1,2}R.H 5.00 8 6 6 0.055 2.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 696 0.006 [HK].G.I..[IV].S 4.54 5 5 5 0.021 2.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 697 0.006 F.LR.T..E 5.00 4 4 4 0.005 2.16e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 698 0.006 G.Y..H..H.Y 5.00 3 3 3 5.26e-04 2.18e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 699 0.006 C..R..H.G.Y 5.00 5 3 3 5.26e-04 2.18e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 700 0.006 FP.R.T..E 5.00 4 4 4 0.005 2.19e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 701 0.006 Y.C..C..[AS] 3.77 7 4 4 0.014 1.33e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 702 0.006 G.IQ..W..L 5.00 3 3 3 5.32e-04 2.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 702 0.006 G..Q.IW..L 5.00 3 3 3 5.32e-04 2.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 704 0.006 K.[FH][KR][HR].H 4.31 5 5 5 0.021 2.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 705 0.006 A[FH][KR][HR].H 4.31 5 5 5 0.021 2.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 706 0.006 H.G.Y..HM 5.00 3 3 3 5.35e-04 2.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 706 0.006 G.Y..HM.H 5.00 3 3 3 5.35e-04 2.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 708 0.006 HR..YCK 5.00 3 3 3 5.38e-04 2.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 708 0.006 HRY..CK 5.00 3 3 3 5.38e-04 2.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 710 0.006 KA.[KR][HR].H 4.54 5 5 5 0.021 2.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 711 0.006 IW..LQ..G 5.00 3 3 3 5.38e-04 2.34e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 712 0.006 G.Y..H.N..Y 5.00 3 3 3 5.41e-04 2.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 713 0.006 IW.RL.E 5.00 3 3 3 5.41e-04 2.38e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 714 0.006 RP..C.IC 5.00 3 3 3 5.43e-04 2.39e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 715 0.006 R..Y.H[ST]G 4.77 4 4 4 0.005 2.44e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 716 0.006 L.E..R[IL]H 4.77 7 5 5 0.021 2.46e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 717 0.006 K.{1,2}HL..H.{0,1}R 5.00 5 5 5 0.021 2.47e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 718 0.006 Q.MNH.Y 5.00 3 3 3 5.50e-04 2.49e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 718 0.006 Y.Q.MNH 5.00 3 3 3 5.50e-04 2.49e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 720 0.006 QHMN..Y 5.00 3 3 3 5.51e-04 2.51e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 721 0.007 [ILM]D[LV][ST] 3.17 18 14 14 1.99 1.53e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 722 0.007 C..CG..F..S 5.00 3 3 3 5.55e-04 2.56e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 723 0.007 L..H..IH 4.00 5 5 5 0.049 1.54e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 724 0.007 S..M..RY..C 5.00 3 3 3 5.55e-04 2.57e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 724 0.007 S..M..R..YC 5.00 3 3 3 5.55e-04 2.57e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 726 0.007 Y.QHMN 5.00 3 3 3 5.56e-04 2.57e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 727 0.007 I.S.W.R.Q 5.00 3 3 3 5.57e-04 2.59e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 728 0.007 G.I.S.W.R 5.00 3 3 3 5.59e-04 2.61e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 729 0.007 RI..[IV].S[KR] 4.54 5 5 5 0.021 2.62e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 730 0.007 A..IQ..W..L 5.00 3 3 3 5.60e-04 2.63e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 731 0.007 H..R.Q..W..L 5.00 3 3 3 5.63e-04 2.67e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 732 0.007 E.PY.C..C 5.00 5 3 3 5.65e-04 2.71e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 733 0.007 Y..D.C.K 4.00 5 4 4 0.015 1.62e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 734 0.007 G.Y..HMN 5.00 3 3 3 5.68e-04 2.75e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 735 0.007 [FLM]..H[ST]..KP 4.40 7 6 6 0.057 2.75e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 736 0.007 RYSYC 5.00 3 3 3 5.69e-04 2.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 737 0.007 H..H.Y.Y.K 5.00 3 3 3 5.70e-04 2.77e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 738 0.007 LK.H.R.H 5.00 4 4 4 0.005 2.78e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 739 0.007 A..I.S.W.R 5.00 3 3 3 5.70e-04 2.78e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 740 0.007 K..QC..C 4.00 4 4 4 0.015 1.67e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 741 0.007 [ST]..[KR]P..C 3.54 15 8 8 0.35 1.67e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 742 0.007 C..C.KA 4.00 5 4 4 0.015 1.67e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 743 0.007 R.Q.IWS 5.00 3 3 3 5.71e-04 2.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 743 0.007 SIW.R.Q 5.00 3 3 3 5.71e-04 2.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 743 0.007 IQS.W.R 5.00 3 3 3 5.71e-04 2.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 746 0.007 RIQ..WS 5.00 3 3 3 5.73e-04 2.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 746 0.007 IQ..WSR 5.00 3 3 3 5.73e-04 2.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 748 0.007 M..R.SYC 5.00 3 3 3 5.73e-04 2.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 748 0.007 M..RYS.C 5.00 3 3 3 5.73e-04 2.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 750 0.007 GRI.S.W 5.00 3 3 3 5.73e-04 2.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 751 0.007 GR..SIW 5.00 3 3 3 5.74e-04 2.83e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 752 0.007 H.RI.S..K 5.00 4 4 4 0.005 2.84e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 753 0.007 P..A..IQ..W 5.00 3 3 3 5.76e-04 2.86e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 754 0.007 C..C..SYK 5.00 3 3 3 5.77e-04 2.87e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 755 0.007 H..R..S.W.R 5.00 3 3 3 5.77e-04 2.88e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 756 0.007 IWSR.Q 5.00 3 3 3 5.79e-04 2.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 756 0.007 Q.IWSR 5.00 3 3 3 5.79e-04 2.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 756 0.007 RIQS.W 5.00 3 3 3 5.79e-04 2.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 756 0.007 QSIW.R 5.00 3 3 3 5.79e-04 2.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 756 0.007 R.QSIW 5.00 3 3 3 5.79e-04 2.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 761 0.008 HLK.H.R 5.00 4 4 4 0.005 2.91e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 762 0.008 P.H..R.Q..W 5.00 3 3 3 5.80e-04 2.92e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 763 0.008 C.[KR].F.[HR] 3.54 10 5 5 0.050 1.77e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 764 0.008 A.RI.S.W 5.00 3 3 3 5.84e-04 2.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 765 0.008 A.R..SIW 5.00 3 3 3 5.86e-04 3.01e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 766 0.008 R.{1,2}H..EKP 5.00 9 5 5 0.022 3.01e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 767 0.008 C.[KR].F.[HR]S 4.54 4 4 4 0.005 3.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 768 0.008 T.H[FL]R.H 4.77 4 4 4 0.005 3.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 769 0.008 RIHS..K 5.00 4 4 4 0.006 3.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 770 0.008 T..E.N.K[LV] 4.77 5 5 5 0.022 3.12e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 771 0.008 P[FY].C 2.77 14 9 9 0.87 1.13e-07 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 772 0.008 C.NC.KR 5.00 3 3 3 5.96e-04 3.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 773 0.008 [HK].G.I..[IV]..[KR] 4.31 5 5 5 0.022 3.18e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 774 0.008 IQ..W..LQ 5.00 3 3 3 5.99e-04 3.22e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 775 0.008 C..C.K..K..H 5.00 3 3 3 6.01e-04 3.25e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 776 0.008 S..M.H.Y.Y 5.00 3 3 3 6.04e-04 3.29e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 777 0.009 Q.IW..LQ 5.00 3 3 3 6.05e-04 3.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 778 0.009 F..RKT.S 5.00 4 4 4 0.006 3.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 779 0.009 C..CGK 4.00 5 4 4 0.016 2.04e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 780 0.009 YS..M.H.Y 5.00 3 3 3 6.11e-04 3.41e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 781 0.009 C..CG.{0,1}R.{0,1}S 5.00 4 4 4 0.006 3.44e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 782 0.009 C..C.K..KH 5.00 3 3 3 6.13e-04 3.44e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 783 0.009 [HR].[KR].[HK].[AG].[KR] 3.84 10 8 8 0.22 3.45e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 784 0.009 H..E..Y..D.C 5.00 3 3 3 6.20e-04 3.57e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 785 0.009 P..C.IC.K 5.00 3 3 3 6.22e-04 3.61e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 786 0.009 IW..L.E.G 5.00 3 3 3 6.23e-04 3.62e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 787 0.009 M.H.YSY 5.00 3 3 3 6.24e-04 3.64e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 788 0.010 I.SIWS 5.00 3 3 3 6.27e-04 3.70e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 789 0.010 R..[ST].E..[FY].C 4.54 6 4 4 0.006 3.72e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 790 0.010 E.PF.C..C 5.00 3 3 3 6.31e-04 3.77e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 791 0.010 L..H.{0,2}R.{1,2}H 4.00 13 9 9 0.55 2.28e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 792 0.010 H..E..Y.CD 5.00 3 3 3 6.34e-04 3.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 793 0.010 P..C..C..R..H 5.00 6 3 3 6.35e-04 3.83e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 794 0.010 C..C.K.F..S 5.00 4 3 3 6.35e-04 3.83e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 795 0.010 C..AF..K.H 5.00 3 3 3 6.36e-04 3.86e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 796 0.010 H..R.Q..WS 5.00 3 3 3 6.39e-04 3.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 797 0.010 IQ..W..L.E 5.00 3 3 3 6.39e-04 3.91e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 798 0.010 H.R.HS 4.00 9 6 6 0.12 2.36e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 799 0.010 R.H..E..Y.C 5.00 5 3 3 6.44e-04 4.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 800 0.010 C..AF..KH 5.00 3 3 3 6.44e-04 4.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 800 0.010 C..AFK..H 5.00 3 3 3 6.44e-04 4.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 802 0.010 I.S.W.R..E 5.00 3 3 3 6.45e-04 4.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 803 0.010 Q.IW..L.E 5.00 3 3 3 6.45e-04 4.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 804 0.010 H..R.QS.W 5.00 3 3 3 6.46e-04 4.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 805 0.011 CD.C.KR 5.00 3 3 3 6.49e-04 4.10e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 806 0.011 C..AF.HK 5.00 3 3 3 6.50e-04 4.12e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 807 0.011 IWS..Q..G 5.00 3 3 3 6.52e-04 4.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 808 0.011 H.G..Q..W..L 5.00 3 3 3 6.52e-04 4.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 809 0.011 C.K.F[ST] 3.77 7 5 5 0.054 2.50e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 810 0.011 Q.M.HR..Y 5.00 3 3 3 6.54e-04 4.18e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 811 0.011 PY.C 3.00 10 7 7 0.42 1.51e-07 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 812 0.011 QHM..R..Y 5.00 3 3 3 6.55e-04 4.21e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 813 0.011 C.KAF.H 5.00 3 3 3 6.56e-04 4.23e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 814 0.011 G.IQ..WS 5.00 3 3 3 6.58e-04 4.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 814 0.011 G..Q.IWS 5.00 3 3 3 6.58e-04 4.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 816 0.011 C..AFKH 5.00 3 3 3 6.58e-04 4.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 817 0.011 Y.Q.M.HR 5.00 3 3 3 6.60e-04 4.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 818 0.011 H.[HY].L..[HK].[HR] 4.31 5 5 5 0.024 4.30e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 819 0.011 Q.M.[HY]R 3.77 5 5 5 0.054 2.59e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 820 0.011 SIW.R..E 5.00 3 3 3 6.61e-04 4.32e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 821 0.011 Y.QHM..R 5.00 3 3 3 6.61e-04 4.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 822 0.011 IW..LQE 5.00 3 3 3 6.61e-04 4.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 823 0.011 HR.L.[HR]..S 4.77 8 5 5 0.024 4.33e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 824 0.011 H.N..Y.Y.K 5.00 3 3 3 6.63e-04 4.36e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 825 0.011 R.Q..W.R.Q 5.00 3 3 3 6.63e-04 4.36e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 826 0.011 N.R..YCK 5.00 3 3 3 6.63e-04 4.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 826 0.011 N.RY..CK 5.00 3 3 3 6.63e-04 4.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 828 0.011 GS..Q.M..R 5.00 4 4 4 0.006 4.39e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 829 0.011 G.IQS.W 5.00 3 3 3 6.65e-04 4.41e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 830 0.011 I..IW.R 4.00 3 3 3 0.003 2.66e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 831 0.011 EH.{1,2}RI 4.00 6 6 6 0.12 2.66e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 832 0.011 G..QSIW 5.00 3 3 3 6.66e-04 4.43e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 833 0.011 Q.M.HRY 5.00 3 3 3 6.68e-04 4.46e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 834 0.012 IWSR..E 5.00 3 3 3 6.69e-04 4.48e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 835 0.012 QHM..RY 5.00 3 3 3 6.69e-04 4.49e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 836 0.012 RI..IW 4.00 3 3 3 0.003 2.76e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 837 0.012 NH.Y.Y.K 5.00 3 3 3 6.75e-04 4.61e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 838 0.012 P[ILMV].[LV][AS] 3.07 29 20 20 5.27 2.78e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 839 0.012 FPLR.T 5.00 4 4 4 0.006 4.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 840 0.012 P.H.G..Q..W 5.00 3 3 3 6.84e-04 4.78e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 841 0.012 Y.Q..N.R..Y 5.00 3 3 3 6.85e-04 4.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 842 0.012 A..IQ..WS 5.00 3 3 3 6.85e-04 4.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 843 0.012 G.I..[IV].S[KR] 4.54 5 5 5 0.024 4.83e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 844 0.012 GR.Q..W.R 5.00 3 3 3 6.87e-04 4.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 845 0.013 C.K.F[AS] 3.77 7 5 5 0.055 2.93e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 846 0.013 K.K.K.[GS].[IV] 4.54 6 6 6 0.063 4.95e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 847 0.013 A..IQS.W 5.00 3 3 3 6.92e-04 4.97e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 848 0.013 K..QC..C..R 5.00 3 3 3 6.92e-04 4.97e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 849 0.013 C.RS[FY] 3.77 5 5 5 0.056 2.99e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 850 0.013 R.H..E..F.C 5.00 3 3 3 6.94e-04 4.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 851 0.013 H..[ILM][HY] 2.40 24 16 16 3.98 1.80e-07 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 852 0.013 Y..H..H..S.C 5.00 3 3 3 6.95e-04 5.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 853 0.013 H.GR..S.W 5.00 3 3 3 6.95e-04 5.04e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 854 0.013 P..C.NC..R 5.00 3 3 3 6.95e-04 5.04e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 855 0.013 HR.L.RT 5.00 5 4 4 0.006 5.07e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 856 0.013 G.Y..HM..R 5.00 3 3 3 6.97e-04 5.08e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 857 0.013 Y.Q..N.RY 5.00 3 3 3 6.99e-04 5.11e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 857 0.013 Q..N.RY.Y 5.00 3 3 3 6.99e-04 5.11e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 859 0.013 AG.I.S.W 5.00 3 3 3 7.00e-04 5.13e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 860 0.013 H[ST]..[KR].[FY].C 4.31 6 4 4 0.006 5.18e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 861 0.013 S.H..H.Y..C 5.00 3 3 3 7.03e-04 5.20e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 862 0.014 [ST]..D.PL..[ST] 4.54 7 7 7 0.13 5.26e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 863 0.014 A.R.Q..W.R 5.00 3 3 3 7.06e-04 5.26e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 864 0.014 S..MN..Y.Y 5.00 3 3 3 7.06e-04 5.28e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 865 0.014 FP..KT..E 5.00 4 4 4 0.006 5.39e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 866 0.014 IQ..WS..Q 5.00 3 3 3 7.13e-04 5.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 867 0.014 QC.KC..R 5.00 3 3 3 7.13e-04 5.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 867 0.014 QC..C.KR 5.00 3 3 3 7.13e-04 5.42e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 869 0.014 YS..MN..Y 5.00 3 3 3 7.14e-04 5.45e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 870 0.014 H[ST]GEK 4.77 7 5 5 0.025 5.46e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 871 0.014 R..[ST]..K..QC 4.77 5 4 4 0.006 5.48e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 872 0.014 H[ST].E.P 3.77 11 9 9 0.58 3.34e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 873 0.014 Q.IWS..Q 5.00 3 3 3 7.19e-04 5.58e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 874 0.014 H..H.YS.C 5.00 3 3 3 7.20e-04 5.59e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 875 0.014 R.Q..W.R..E 5.00 3 3 3 7.20e-04 5.59e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 876 0.014 H..H..SYC 5.00 3 3 3 7.21e-04 5.62e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 877 0.015 HA.R..S.W 5.00 3 3 3 7.25e-04 5.70e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 878 0.015 H.G.Y.Q.M 5.00 3 3 3 7.25e-04 5.71e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 878 0.015 G.Y.Q.M.H 5.00 3 3 3 7.25e-04 5.71e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 880 0.015 MN..YSY 5.00 3 3 3 7.27e-04 5.76e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 881 0.015 F.L..T.S..N 5.00 4 4 4 0.006 5.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 882 0.015 P..C..C..SY 5.00 3 3 3 7.31e-04 5.84e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 883 0.015 YSYCK 5.00 3 3 3 7.33e-04 5.89e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 884 0.015 HRP..RT 5.00 5 4 4 0.006 5.92e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 885 0.015 P..C..CD 4.00 4 4 4 0.018 3.58e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 886 0.016 K.Y.C..C.{0,1}K 5.00 5 3 3 7.39e-04 6.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 887 0.016 PY.C..C..S 5.00 3 3 3 7.39e-04 6.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 887 0.016 P..C.YC..S 5.00 3 3 3 7.39e-04 6.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 889 0.016 EH.RI.S 5.00 4 4 4 0.007 6.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 890 0.016 R..Q.[MV]..R..[GS] 4.54 5 5 5 0.025 6.11e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 891 0.016 P..C.I..K.F 5.00 3 3 3 7.42e-04 6.11e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 892 0.016 H.G..Q..WS 5.00 3 3 3 7.42e-04 6.13e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 893 0.016 E..RIHS 5.00 4 4 4 0.007 6.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 894 0.016 F..R.T.SE 5.00 4 4 4 0.007 6.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 895 0.016 G.Y.QHM 5.00 3 3 3 7.43e-04 6.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 896 0.016 CGK.F 4.00 4 4 4 0.018 3.70e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 897 0.016 C..C.K..K 4.00 4 4 4 0.018 3.75e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 898 0.016 C.IC.{0,1}K.{1,2}F 5.00 3 3 3 7.48e-04 6.27e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 899 0.016 H.G..QS.W 5.00 3 3 3 7.51e-04 6.35e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 900 0.016 G..Q..W.R.Q 5.00 3 3 3 7.52e-04 6.36e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 900 0.016 Q..W.R.Q..G 5.00 3 3 3 7.52e-04 6.36e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 902 0.017 Q..N..Y..CK 5.00 3 3 3 7.54e-04 6.43e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 903 0.017 C..A..H.HH 5.00 3 3 3 7.55e-04 6.44e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 904 0.017 R.[HR]..E..[FHY] 3.40 10 8 8 0.39 3.91e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 905 0.017 F.L.KT..E 5.00 4 4 4 0.007 6.60e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 906 0.017 H[KR]..HTG 4.77 4 4 4 0.007 6.62e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 907 0.017 H..[HR].[HY].Y 3.54 5 5 5 0.059 3.97e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 908 0.017 G.I..IW 4.00 3 3 3 0.003 3.99e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 909 0.017 H[ST]G..P..C 4.77 9 4 4 0.007 6.67e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 910 0.017 HRY.Y.K 5.00 3 3 3 7.64e-04 6.67e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 911 0.017 P..C..C..A..H 5.00 3 3 3 7.64e-04 6.68e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 912 0.017 Q.MN.R..Y 5.00 3 3 3 7.66e-04 6.72e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 913 0.017 P..C.{0,1}N.{0,1}C 4.00 6 5 5 0.059 4.04e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 914 0.017 C.K.F..K.H 5.00 3 3 3 7.68e-04 6.78e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 915 0.018 Y.Q.M..R 4.00 4 4 4 0.019 4.09e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 916 0.018 C.K.[FL][ST] 3.54 9 7 7 0.25 4.11e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 917 0.018 Y.Q.MN.R 5.00 3 3 3 7.72e-04 6.88e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 918 0.018 HM..R..Y.K 5.00 3 3 3 7.73e-04 6.91e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 919 0.018 K[HY].[HY].L..[HK] 4.31 5 5 5 0.026 6.94e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 920 0.018 PLD.S 4.00 9 9 9 0.59 4.19e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 921 0.018 C.K.F..KH 5.00 3 3 3 7.76e-04 6.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 921 0.018 C.K.FK..H 5.00 3 3 3 7.76e-04 6.99e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 923 0.018 S.H.N..Y..C 5.00 3 3 3 7.78e-04 7.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 924 0.018 KH[HK].[HY]..[DE] 4.31 5 5 5 0.026 7.07e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 925 0.018 M.HR..Y.K 5.00 3 3 3 7.80e-04 7.09e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 926 0.018 Q.MN.RY 5.00 3 3 3 7.80e-04 7.12e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 927 0.018 [HK]R..H[ST]G 4.54 5 5 5 0.026 7.13e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 928 0.018 C.K.F.HK 5.00 3 3 3 7.81e-04 7.14e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 929 0.019 H.P..RTQ 5.00 4 4 4 0.007 7.21e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 930 0.019 R.H..E[KR] 3.77 9 7 7 0.25 4.34e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 931 0.019 C..C..R..H..S 5.00 4 3 3 7.85e-04 7.26e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 932 0.019 C.K.FKH 5.00 3 3 3 7.89e-04 7.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 933 0.019 P.DL..K[HR] 4.77 5 5 5 0.026 7.40e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 934 0.019 H.GE..Y.C 5.00 5 3 3 7.93e-04 7.47e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 935 0.019 H.N..YS.C 5.00 3 3 3 7.93e-04 7.48e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 936 0.019 HM.H..S.C 5.00 3 3 3 7.94e-04 7.49e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 937 0.019 LDLS 4.00 10 9 9 0.60 4.50e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 938 0.019 HR.L..TQ 5.00 4 4 4 0.007 7.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 938 0.019 H..L.RTQ 5.00 5 4 4 0.007 7.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 940 0.019 RI.S.W..L 5.00 3 3 3 7.96e-04 7.54e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 941 0.019 C..C..[AS]..[HR] 3.54 5 5 5 0.061 4.53e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 942 0.019 R..SIW..L 5.00 3 3 3 7.97e-04 7.58e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 943 0.019 G.K..QC..C 5.00 3 3 3 7.97e-04 7.59e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 944 0.020 C..CG 3.00 10 6 6 0.27 2.75e-07 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 945 0.020 L.EH.R.H 5.00 6 4 4 0.007 7.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 946 0.020 A..I..IW 4.00 3 3 3 0.003 4.65e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 947 0.020 R.H.GE 4.00 8 6 6 0.14 4.66e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 948 0.020 I.S.W.RL 5.00 3 3 3 8.04e-04 7.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 949 0.020 C..C..R..HS 5.00 3 3 3 8.04e-04 7.79e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 950 0.020 Q.L.{1,2}L..K 4.00 11 10 10 0.83 4.70e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 951 0.020 C..[AS][FY] 2.54 14 11 11 1.66 2.82e-07 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 952 0.020 NH.YS.C 5.00 3 3 3 8.10e-04 7.94e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 953 0.020 HK.{0,2}L..H..L 5.00 5 5 5 0.027 7.98e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 954 0.021 NH..SYC 5.00 3 3 3 8.11e-04 8.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 955 0.021 YS..M..R..Y 5.00 3 3 3 8.12e-04 8.01e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 956 0.021 H.C..C.{0,1}K.{1,2}F 5.00 3 3 3 8.12e-04 8.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 956 0.021 C..C.{0,1}K.{1,2}F.H 5.00 8 3 3 8.12e-04 8.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 958 0.021 [HR][IL]..GE[HK] 4.31 8 6 6 0.069 8.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 959 0.021 D.P.DLS 5.00 5 5 5 0.027 8.06e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 960 0.021 C..C.K..[AS]..[GS] 4.54 6 4 4 0.007 8.07e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 961 0.021 H[HK].[KR].H..[IL] 4.31 5 5 5 0.027 8.08e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 962 0.021 HT..RP[FH] 4.77 4 4 4 0.007 8.11e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 963 0.021 Y..H.NHR 5.00 3 3 3 8.17e-04 8.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 963 0.021 H.NHR..Y 5.00 3 3 3 8.17e-04 8.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 965 0.021 IWS..QE 5.00 3 3 3 8.17e-04 8.17e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 966 0.021 [KR].[HR].[KR].[HK]..E 4.07 7 7 7 0.14 8.19e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 967 0.021 S..M..RY.Y 5.00 3 3 3 8.19e-04 8.22e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 968 0.021 E..RIH 4.00 5 5 5 0.062 4.98e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 969 0.021 D.{1,2}RC.{0,1}K.R 5.00 4 4 4 0.007 8.30e-11 4 4 4
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 970 0.022 SIW.RL 5.00 3 3 3 8.25e-04 8.40e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 971 0.022 [ST].E[KR]P..C 4.54 7 5 5 0.027 8.50e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 972 0.022 YS..M..RY 5.00 3 3 3 8.28e-04 8.50e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 973 0.022 G.Y.Q..N..Y 5.00 3 3 3 8.30e-04 8.55e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 974 0.022 FPL.KT 5.00 4 4 4 0.007 8.60e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 975 0.022 D..LDLS 5.00 5 5 5 0.027 8.66e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 976 0.022 H.NHRY 5.00 3 3 3 8.34e-04 8.69e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 977 0.022 IWSRL 5.00 3 3 3 8.35e-04 8.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 978 0.023 G..Q..W.R..E 5.00 3 3 3 8.38e-04 8.81e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 979 0.023 L.{1,2}H.RL..G 5.00 5 5 5 0.027 8.82e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 980 0.023 [AS]..[HR]..HL..H 4.54 5 5 5 0.027 8.85e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 981 0.023 P..C..C..SF 5.00 3 3 3 8.41e-04 8.90e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 982 0.023 R.KQ.{0,2}A..R 5.00 5 5 5 0.028 9.00e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 983 0.023 AG..Q..W.R 5.00 3 3 3 8.44e-04 9.02e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 984 0.023 M..RYSY 5.00 3 3 3 8.45e-04 9.03e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 985 0.023 H..H..RI..I 5.00 3 3 3 8.46e-04 9.05e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 986 0.023 Q..W.R..E.G 5.00 3 3 3 8.49e-04 9.15e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 987 0.024 FPLRK 5.00 4 4 4 0.007 9.24e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 988 0.024 H[ST]G.KP 4.77 7 5 5 0.028 9.34e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 989 0.024 [ST]..DQP[LV] 4.54 6 6 6 0.071 9.37e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 990 0.025 E..Y.C..C.{0,1}K 5.00 5 3 3 8.66e-04 9.72e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 991 0.025 E[KR]P[FY].C 4.54 6 4 4 0.007 9.73e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 992 0.025 IQ.IW 4.00 3 3 3 0.003 5.86e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 993 0.025 AGR.Q..W 5.00 3 3 3 8.68e-04 9.80e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 994 0.025 [HK][HR][HKR].[HY]..[DE] 3.71 7 7 7 0.14 9.95e-11 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 995 0.026 C.{0,2}P.C.K 4.00 5 5 5 0.064 6.04e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 996 0.026 MNH..S.C 5.00 3 3 3 8.79e-04 1.02e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 997 0.026 C.[KR].F..S 3.77 7 5 5 0.064 6.13e-09 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 998 0.026 F..R.T.S.P 5.00 4 4 4 0.007 1.03e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 999 0.026 W.R.QE.G 5.00 3 3 3 8.82e-04 1.03e-10 1 29 29
slimfinder CtBP-NoEFilter FreqDisComp-5-8 l5w2o2a3 Sig 00:33:50 29 29 17505 1000 1000 0.026 Q..W.R.QE 5.00 3 3 3 8.82e-04 1.03e-10 1 29 29
slimfinder.occ.csv is too large to return (1.36 MB > 1 MB) in full output. Try[&password=X].
slimfinder: 29 Seq, 29 UPC, 1000 Sig SLiMs in 4 Clouds

Cloud 1 (995 SLiMs):	P..C..C.[KR].[FY]	P..C..C..[AS][FY]	P..C..C.[KR].F	[ST]..KP..C..C	C..C.[KR][AS][FY]	[KR]P..C..C.[KR]	C..C.[KR].[FY]	H..E..[FY].C..C	KP..C..C.{1,2}R	[ST]..[KR]P..C..C	P..C..C.[KR][AS]	PY.C..C.[KR]	C..C..[AS][FY]	H..E.P..C..C	E.P[FY].C..C	C..CG[KR].[FY]	P..C..C.[KR]	C..C..S[FY]	H[ST]..[KR]P..C	P..C..C..[AS]F	KP..C..C	RP[FHY].C..C	P..C..C..S[FY]	[HY].C..C..[AS][FY]	[KR]P[FY].C..C	C..C.[KR].F	C..C.[KR][AS]F	C..C..[AS][FY]K	[KR]P..C..C..[AS]	R..[ST]..[KR]P..C	P[HY].C..C.[KR]	H..E.P[FY].C	P..C..C.[KR]..K	P..C..C..[AS]	P..C..C.{1,2}R.{0,1}S	P[FY].C..C	R.H..E.P..C	[KR].Y.C..C.K	R.[FHY].C..C	P..C..C.{1,2}R	R.[HY].C..C.K	[KR]P..C..C	P..C..C..[AS].K	C..C.{1,2}R.{0,1}F	K.{0,1}P..C..C	PY.C..C	[KR].[FY].C..C	C..C.[KR].F.[HR]	P..C..CG..[FY]	[ST].E.P..C..C	C..C.RS[FY]	Y.C..C.K.F	C..C.[KR].F..S	Y.C..C.[KR]	KP..C..CG	C..CG..[FY]	C..C.[KR].[FY]K	P[FHY].C..C	C..C..[AS]F.[HR]	C..C.{1,2}R.{0,1}F.{0,2}S	P..C..C.{1,2}R.{0,1}F	C.[KR].F.[HR]..H	E..[FY].C..C	P..C..C.RS	Y.CD.C.K	C..C..[AS]F	C..C..[AS]..[HR]..H	[KR]P.QC..C	C..C.[KR][AS]	H[ST].E.P..C	S..KP..C..C	[HY].C..C.K.F	C..CGK.F	Y.C..C.K	P..C..CG[KR]	[KR]P..C..CG	C..C.K.F	RP..C..C	Y.C..C..S[FY]	C..C.{1,2}R.{0,1}S	[FY].C..C.[KR]	C..[AS]F.[HR]..H	PY.C..C.K	P..C..C.K.F	Y.C..C.{0,1}K.{1,2}F	G..PY.C..C	E[KR]P..C..C	R..[ST].E.P..C	P[HY].C..C..[AS]	C..CD[KR].F	T..R.[FH].C..C	[HY].C..C.[KR]	G.{0,1}K.Y.C..C	KP..C.{0,1}D.{0,1}C	R.[HY].C..C..A	[HY].C..C.[KR][AS]	E.P..C..C	C..CG[KR]	PY.C..C.{1,2}R	HS..KP..C	E..[FY]QC..C	C..C..SF	H.G..P..C..C	C..C.[KR]..K	P[FY]QC..C	Y.C..C.{0,1}K	E..[FY].C..CG	T..RP..C..C	PY.C..C.{0,1}K	C..C.[KR][AS].K	[HY].C..C..[AS]F	P..C..C..[AS]..[HR]	H.G..PY.C	P..C..C	C.{0,1}D.{0,1}CD..F	C..C.K.F[ST]	C..C.K.F[AS]	[HY].C..C.K..K	P[FY].C..CG	KP..C..C.R	RP..C..C.K	P..C..C..S	H.{0,1}R.{1,2}H.GE	[HY].C..C..[AS]	H..E[KR]P..C	R..S..KP..C	KP.QC..C	[KR].[FY].C..CG	C..C.[KR][AS]..[HR]	C..C..[AS].K	G..P[HY].C..C	Y.C..CD..F	Y.C..C	P..C..C.K..K	L..H.{0,1}R.{1,2}H.G	P..C.{0,1}D.{0,1}C.{1,2}R	C.[DE]C.[KR].F	H.{0,1}R.{1,2}H.G..P	[FY].C..C	R.{1,2}H.GE.P	E.P.QC..C	Y.C..CD	Y.CD.C	[ST]..KP..C	C..C.[KR]	E[KR].[FY].C..C	C.[KR][AS][FY]	P..C..C.R	C..CD..F	C.[KR][AS]F.[HR]	HT..RP..C	P.QC..C	C..C..RF	[FHY].C..C	P..C..C.{0,1}K.{1,2}F	GE.P..C..C	E.P..C..CG	Y.C..C.{1,2}R.{0,1}S	H..E.P..C	P..C..CD[KR]	C..CG..F	K.Y.C..C	[KR].F.[HR]..HL	RP..C..C.{0,1}K	C..C.RS	C..C.{0,1}K.{1,2}F	P..C..CG	KP..C..C..S	[ST].E..[FY].C..C	Y.C..C.{0,1}K.{0,2}K	KA[FH].[HR].H	C..CD[KR]	[HY].C..C..[AS].K	C.IC.K.F	R.H.G..P..C	E.P[FY].C	C..C..AF.H	[KR]..QC..C	H.C..C.K.F	C..C.K.F.H	CG[KR].[FY]	P..C..CG.{0,1}R	H.G..P[HY].C	C.[KR][AS][FY]K	T..RP[FH].C	H..E..Y.C..C	Y.C.NC.K	K.Y.C.NC	H..E.P.QC	C.[KR][AS]..[HR]..H	KA[FH][KR]..H	Y.C..C.{1,2}R	[ST]..[KR].[FY].C..C	C.NC.K.F	Y.C.N..K.F	YQC..C.K	Y.C..C..S	CD.C.K.F	C..C..S	[ST]G..P..C..C	H.{0,1}R.{1,2}H.G.K	C.NC..R..H	Y..D.C.K.F	H.GE.P..C	YEC.NC	RP[FHY].C	C..C..AF..K	K.Y.C..CG	C..C..A..H..H	E.P[FY]QC	C..C..A..H.H	C..C..AFK	C..C.KAF	[FY]QC..C	QC..C.K.F	R.{1,2}H.GEK	E..Y.CD.C	C..C..[AS]	PY.C..CD	PY.CD.C	I.S..KP..C	CD.C..R..H	K.Y.C..C.K	PYQC..C	P..C.YC.R	P..C..CD..F	[FY].C..CG	QC..C..R..H	[ST]..[KR]..QC..C	P..C..C.R.F	[KR]P[FY].C	C..C.K.F..K	C..C.K.FK	GE..Y.C..C	H..E.P..C.{0,1}N	C.K.F.H..H	R.{1,2}H.G.KP	C.K.F.H.H	KPY.C..C	E..Y.C..C.K	C..AF.H..H	C..AF.H.H	R.H.C..C.K	C..C.KR..H	C.KC..R..H	K.YEC..C	YEC..C.K	C.[KR][AS]F	C..C..R..H.G	CP.C.K.F	P..C..CG..F	C.YC.RS	G.R.H.C..C	C.NC.K	H.{0,1}R.{1,2}H..EK	C..S[FY]	C..C..A.K..H	P..C..C..AF	E.P..C.{0,1}N.{0,1}C	C..CD..F..S	PY.C..CG	EC..C.K.F	C..[AS][FY]K	C..C..A..HK	C..C.KA..H	C..C..A.KH	C..C.R.F..S	CD.C.K	[KR][AS]F.[HR]..H	Y.C.NC.{0,1}K	C..C..RFS	C.[KR].F..S..L	H.{1,2}K.H.R.H	C..CD	C..C.RSF	C.[KR].[FY]	Y.C..C..[AS]	K.[FH][KR][HR].H	RP..C.IC	C..CG..F..S	E.PY.C..C	Y..D.C.K	K..QC..C	[ST]..[KR]P..C	C..C.KA	C..C..SYK	C.[KR].F.[HR]	R.{1,2}H..EKP	C.[KR].F.[HR]S	P[FY].C	C.NC.KR	C..C.K..K..H	C..CGK	C..CG.{0,1}R.{0,1}S	C..C.K..KH	P..C.IC.K	P..C..C..R..H	C..C.K.F..S	C..AF..K.H	C..AF..KH	C..AFK..H	CD.C.KR	C..AF.HK	C.K.F[ST]	PY.C	C.KAF.H	C..AFKH	C.K.F[AS]	K..QC..C..R	C.RS[FY]	P..C.NC..R	QC.KC..R	QC..C.KR	P..C..C..SY	P..C..CD	K.Y.C..C.{0,1}K	PY.C..C..S	P..C.YC..S	P..C.I..K.F	CGK.F	C..C.K..K	C.IC.{0,1}K.{1,2}F	H[ST]G..P..C	P..C..C..A..H	P..C.{0,1}N.{0,1}C	C.K.F..K.H	C.K.[FL][ST]	C.K.F..KH	C.K.FK..H	C.K.F.HK	C..C..R..H..S	C.K.FKH	C..C..[AS]..[HR]	G.K..QC..C	C..CG	C..C..R..HS	C..[AS][FY]	H.C..C.{0,1}K.{1,2}F	C..C.{0,1}K.{1,2}F.H	C..C.K..[AS]..[GS]	[ST].E[KR]P..C	P..C..C..SF	E..Y.C..C.{0,1}K	E[KR]P[FY].C	C.[KR].F..S	C..[AS]..[HR]..HL	R.Y.C..C.K	Y.C..CDK	[AS]F.[HR]..HL	A[FH][KR][HR].H	C..A..H.HH	H.R.H[ST]..K	R.H[ST].E.P	R.H[ST]..[KR]P	R.H..E[KR]P	H.R..[ST]..KP	H[FLM]..H[ST]..K	H.R..[ST].E.P	R.H[ST].E[KR]	L..H.R..[ST]..K	H.R.HS..K	H.R..[ST]G..P	R.H[ST]G..P	[FLM][KR].[HR][ST]..K	R.H.G.KP	H[ST].E[KR]P	R.H..EKP	H[FLM]R..[ST]..K	[FLM]R.H[ST]..K	H[ST]GE.P	H.GEKP	H..E[KR].[FY].C	H[LM]..HS..K	R..[ST].E[KR]P	H.R..[ST]G.K	H.R..S..KP	R.H[ST]G.K	R.HS..KP	H..IHS..K	K.H.R..[ST]..K	H[ST].E..[FY].C	R..[ST]GE.P	[LM][KR].[HR]S..K	H.R..[ST].EK	[FLM]..H[ST]..KP	H.RI.S..K	RIHS..K	R..[ST].E..[FY].C	H[ST]..[KR].[FY].C	H[ST]GEK	R..[ST]..K..QC	H[ST].E.P	H[ST]G.KP	KA.[KR][HR].H	HT..R.[FH].C	Y.[HK].G.[KR]P	HT..RP[FH]	R.H..E..[FY].C	H.R.H..E.P	H.R.H[ST].E	H.R.H.GE	R.[HR]..E.P[FHY]	L..H.R.H..E	R.H..E.P[FY]	H.R.H..E..[FY]	R.H.GE.P	R.H..E.P	H..E..[FY].C	R.[HR]..E.P	[HR].[KR].[HK].[AG]E	H.R.H..EK	[LV]..[HR].[KR].[HK]..E	H.R.H..E	R.H[ST]GE	H..E..[FY]QC	R.H.GEK	R.HT.E.P	[HR].[KR].[HK]..E[KR]	H..E..F.C..C	R.F.C..CG	R.H..E..[FY]	[FY].C.QC	H.R.HT.E	R.H..E..[FY]Q	[KR].[HK].[AG]E[KR]	K.H.R.H..E	R.H[ST].E	H..E..Y..D.C	E.PF.C..C	H..E..Y.CD	R.H..E..Y.C	R.H..E..F.C	R.[HR]..E..[FHY]	R.H..E[KR]	H.GE..Y.C	R.H.GE	HK.{0,2}L..H..L	[KR].[HR].[KR].[HK]..E	L.{1,2}H.RL..G	YC.{1,2}R	H.R.H.G..P	C.{0,1}D.{0,1}C.{1,2}R.{0,1}F	L..H.R.H[ST]	T.H.R.H[ST]	H[FLM]R.H[ST]	H.R.H[ST]G	H.R.H[ST]	H.R.H.G.K	H[KR]..[HY].[AG].[KR]	K.H.R.H[ST]	H[KR]..H.G..P	H[LM]R.HS	H.RIHS	H[KR]..H.G.[KR]	EH..IHS	R..Y.H[ST]G	[HR].[KR].[HK].[AG].[KR]	H.R.HS	E..RIHS	H[KR]..HTG	T.{1,2}K.{0,1}P..C..C	H.R..[ST]GE	L..H.R..[ST]G	L..H.R..[ST].E	HL..H.R..[ST]	EH.RI.S	[HR][IL]..GE[HK]	Y..H.N..Y..C	H.N..Y.YC	HMN..Y..C	Y..H.N..Y.Y	Y..HMN..Y	HMN..Y.Y	H.NH.Y..C	HL..H.{0,1}R.{1,2}H	H.N.RY..C	H.N.R..YC	Y..H.NH.Y	H.NH.Y.Y	QH.N..Y..C	Y..HMNH	HMNH.Y	Y..H.N.R..Y	Y..H.N.RY	H.N.RY.Y	L..H.[KR].H	H.N..Y..CK	Y.QH.N..Y	QH.N..Y.Y	Y..HMN.R	HMN.R..Y	HMN.RY	G.Y..H.N..Y	QHMN..Y	Y.QHMN	G.Y..HMN	H.N..Y.Y.K	S.H.N..Y..C	H.N..YS.C	Y..H.NHR	H.NHR..Y	H.NHRY	L..H.R.H.G	L..[HR].R[IL][HK]	HL..H.R.H	LK.[HR].R.[HK]	H[FLM]R.H	K.[HR].R[IL][HK]	L..H.R.H	H.{0,1}L..H.R.H	T.H.R.H	K.H.RIH	L..H.R[IL]H	EH.RIH	H.R.H.G	L..H.RIH	H.K.H.R.H	H.RIH	K.H.R.H.G	K.[HR].R.[HKR]	H[ILM][KR].H	L.E..RIH	L.E..R[IL]H	LK.H.R.H	L.EH.R.H	E..RIH	EH.{1,2}RI.S	E.{0,1}PN.K.R	K.{1,2}HL..H.R	H.{1,2}RI.S	K.{1,2}HL..H.{0,1}R	F.[HR]..HL..H	C..R..H.G.Y	[HK]R..H[ST]G	[AS]..[HR]..HL..H	L..H.{1,2}R.{0,1}H	HL..H.{1,2}R.{0,1}H	[HK]..HL..H.R	KH[HK].[HY]..[DE]	[HK][HR][HKR].[HY]..[DE]	L..H.{1,2}R.H	L.EH.{1,2}R.H	QC.{1,2}CG	R.{1,2}HT.E.P	L.{0,1}E.{0,1}H.{1,2}R.H	L..H[KR]..H.G	S..R..Y.H.G	H.{0,1}R.{1,2}H..E.P	R.{1,2}H..E.P	L..H.{0,1}R.{1,2}H..E	K..H.{0,1}L..H.R	HLK.H.R	H.[HY].L..[HK].[HR]	S.L..H[KR]..H	[HR]H[FILM]..H	[HR]H[FIL][KR].H	L..H..[ILM]H	[HR][HK][FILM]..H	LK.[HR]..[IL][HK]	LK.H..IH	H[HK]L..H..L	H[HK]L..H..[IL]	L..H..IH	L..H.{0,2}R.{1,2}H	K[HY].[HY].L..[HK]	H.G.Y..HM	H.G.Y.Q.M	K.{1,2}QC.{1,2}C	K.{1,2}QC.{1,2}CG	N.RY.YC	MN.R..YC	MN.RY..C	MN.RY.Y	NHRY..C	NHR..YC	NHRY.Y	MNHR..Y	MNHRY	Q..N.RY..C	Q..N.R..YC	N.R..YCK	N.RY..CK	Y.Q..N.R..Y	Y.Q..N.RY	Q..N.RY.Y	Q.MN.R..Y	Y.Q.MN.R	Q.MN.RY	[HR]H.[KR].H	TRH.R.H	H..[IL][HY]	K.H..IH	T.H[FL]R.H	H..[ILM][HY]	[FL]..R.R..Q.[MV]	K.{0,1}R.{0,1}R	H[HK].[KR].H..[IL]	[FM]..RK.[AG]..P	S.[IL]..K[MV].E	S.L..[HK]..E[HR]	R.R..Q..[AG].R	R.K.{1,2}K.A..R	R.R..Q.[MV][AG]	R..Q.[MV][AG].R	R.KQ.{0,2}A..R	R.R..Q.[MV]..R	Q[HK][MV]..R.S	R..Q.[MV]..R[KR]	R..Q.[MV]..R..[GS]	M.H.Y.YC	MN..Y.YC	M..RY.YC	H[KR]..YC	H..H.Y.YC	NH.Y.YC	HM..R..YC	M.HR..YC	HRY.YC	Q..N..Y.YC	H.Y.YCK	Q.M..R..YC	N..Y.YCK	M..R..YCK	H..HR..YC	RY.YCK	H.YSYC	M.H..SYC	N..YSYC	Y.{0,1}YC	HR..YCK	S..M..R..YC	RYSYC	M..R.SYC	H..H..SYC	YSYCK	NH..SYC	HM.H.Y..C	[HY].Q[FH][LM].[HK]	MNH.Y..C	Q.M.H.Y..C	M.HRY..C	Y..HM.H.Y	HM.H.Y.Y	MNH.Y.Y	M.H.Y..CK	Y.Q.M.H.Y	Q.M.H.Y.Y	M.HRY.Y	M.H.Y.Y.K	S..M.H.Y..C	M.H.YS.C	HM.HR..Y	Y..HM.HR	HM.HRY	Y.QHM.H	QHM.H.Y	G.Y..HM.H	Q.MNH.Y	Y.Q.MNH	S..M.H.Y.Y	YS..M.H.Y	M.H.YSY	Q.M.HR..Y	Y.Q.M.HR	Q.M.[HY]R	Q.M.HRY	G.Y.Q.M.H	M.HR..Y.K	HM.H..S.C	MNH..S.C	S.L.R[HR]K	EH.{1,2}RI	Y..H..H.Y..C	HM..RY..C	Y..H..H.Y.Y	Y.Q..N..Y..C	Q.MN..Y..C	Q.M..RY..C	Y..HM..R..Y	Y..HM..RY	HM..RY.Y	MN..Y..CK	Y.Q..N..Y.Y	QH..H.Y..C	M..RY..CK	H..HRY..C	Y.Q.MN..Y	Q.MN..Y.Y	Q..NH.Y..C	Y.Q.M..RY	H..H.Y..CK	Y..H..HR..Y	MN..Y.Y.K	Y.QH..H.Y	QH..H.Y.Y	Y..H..HRY	H..HRY.Y	NH.Y..CK	S..MN..Y..C	Q..NH.Y.Y	Y.Q..NH.Y	MN..YS.C	G.Y..H..H.Y	HRY..CK	S..M..RY..C	H..H.Y.Y.K	M..RYS.C	Y.QHM..R	QHM..RY	NH.Y.Y.K	Y..H..H..S.C	G.Y..HM..R	S.H..H.Y..C	S..MN..Y.Y	YS..MN..Y	H..H.YS.C	MN..YSY	G.Y.QHM	Q..N..Y..CK	H..[HR].[HY].Y	NH.YS.C	YS..M..RY	G.Y.Q..N..Y	Q.M..RY.Y	M..RY.Y.K	QHM..R..Y	HRY.Y.K	HM..R..Y.K	S..M..RY.Y	M..RYSY	Y.Q.M..R..Y	YS..M..R..Y	G.Y.Q.M..R	Y.Q.M..R	G..S.H..H.{0,2}R	[AG][GS]..Q.[IM]..R	GS..Q.M..R	IW.R..E..L	R.T..E.N.K	F..R.T..E.N	R.T..E.N..[LV]	F.L..T..E.N	F..R.T..E..L	T..E.N.K[LV]	C.{1,2}C.{1,2}R	[HK].GRI..[IV]	GRI..IW	GRI..[IV].S	GRI..[IV]..[KR]	GR.Q.IW	GRIQ..W	GRI.{1,2}I.{1,2}S	H.GR.Q..W	C.{1,2}CG	GRI.S.W	GR..SIW	GR.Q..W.R	H.GR..S.W	AGR.Q..W	HR.L.[HR]..S	HR.L.RT	HR.L..TQ	H..L.RTQ	F..R.T.S..N	F..RKT..E	FP.RKT	F.LRKT	F..RK..S..N	KT.S.PN	F..R.T..EP	F.LR.T..E	FP.R.T..E	F..RKT.S	FPLR.T	FP..KT..E	F..R.T.SE	F.L.KT..E	FPL.KT	FPLRK	F..R.T.S.P	V..R.{1,2}SP	H.{1,2}Y.{0,1}YC	H.{1,2}Y.{0,1}YC.{1,2}R	H..H..R.Q..W	H..H.G..Q..W	H..H..R..S.W	H.{1,2}EH.G.{0,1}R	H..H..RI..I	H.G.I..IW	HA..I..IW	RI..IW.R	G.I..IW.R	A..I..IW.R	A.RI..IW	I..IW.R.Q	H..R.Q.IW	IQ.IW.R	RIQ.IW	I..IW.R..E	AG.I..IW	H.G.IQ..W	H.G..Q.IW	G.IQ.IW	HA..IQ..W	A..IQ.IW	I..IW.RL	G.I..IW..L	A..I..IW..L	P..A..I..IW	IQ.IW..L	I.SIW.R	I..IWSR	R.Q.IW.R	RIQ..W.R	RI..[IV]..[KR]..E	G.I..IWS	G.IQ..W.R	G..Q.IW.R	IW.R.Q..G	G.I.SIW	A..I..IWS	A..I.SIW	H..R.Q..W.R	A..IQ..W.R	A.R.Q.IW	A.RIQ..W	IQ..W.R.Q	IQ.IWS	Q.IW.R.Q	IQSIW	G.I..[IV]..[KR]..E	I..[IV]..[KR]..E.G	IW.R..E.G	IQ..W.R..E	Q.IW.R..E	H.G..Q..W.R	IW.R.QE	AG.IQ..W	AG..Q.IW	HA.R.Q..W	R.Q.IW..L	IQ..W.RL	Q.IW.RL	[HK]..RI..[IV]..[KR]	R..SIW.R	IW.RLQ	HAG..Q..W	[HK].G.I..[IV].S	G.IQ..W..L	G..Q.IW..L	IW.RL.E	G.I.S.W.R	RI..[IV].S[KR]	A..IQ..W..L	A..I.S.W.R	R.Q.IWS	SIW.R.Q	IQS.W.R	IQ..WSR	P..A..IQ..W	IWSR.Q	Q.IWSR	QSIW.R	R.QSIW	A.R..SIW	[HK].G.I..[IV]..[KR]	Q.IW..LQ	Q.IW..L.E	H.G..Q..W..L	G.IQ..WS	G..Q.IWS	SIW.R..E	R.Q..W.R.Q	G.IQS.W	I..IW.R	G..QSIW	IWSR..E	P.H.G..Q..W	A..IQ..WS	G.I..[IV].S[KR]	A..IQS.W	AG.I.S.W	A.R.Q..W.R	Q.IWS..Q	R.Q..W.R..E	H.G..Q..WS	H.G..QS.W	G..Q..W.R.Q	Q..W.R.Q..G	G.I..IW	A..I..IW	SIW.RL	IWSRL	G..Q..W.R..E	AG..Q..W.R	Q..W.R..E.G	IQ.IW	Q..W.R.QE	H..RI..IW	RI..IW..L	I..IW..LQ	RI..IWS	RI.SIW	H..R..SIW	I..IW..L.E	I..IWS..Q	I..IWS.L	I.SIW..L	RI.S.W.R	IW..LQ..G	I.S.W.R.Q	H..R..S.W.R	IW..L.E.G	I.SIWS	IQ..W..L.E	I.S.W.R..E	IWS..Q..G	IW..LQE	RI..IW	R..SIW..L	I.S.W.RL	IWS..QE	W.R.QE.G	F.L..T.S..N	[ST]..D.PL..[ST]	C.{0,2}P.C.K	H..RIQ..W	H..RI.S.W	H.G.I.S.W	HA..I.S.W	[HK]..RI..[IV].S	RIQ..W..L	H..R.Q..W..L	RIQ..WS	RIQS.W	P.H..R.Q..W	A.RI.S.W	H..R.Q..WS	H..R.QS.W	K.K.K.[GS].[IV]	HA.R..S.W	RI.S.W..L	IQ..W..LQ	IQ..WS..Q	HRP..RT	H.P..RTQ	D.P[IL]DL	P[IL]DLS	P.DLS	P[ILMV][DE]L	QPL.[LV][ST]	D.PLDL	PLDLS	P[IL]D.[ST]	[ILM]DL[GS]	PLDL	P.[DE]L[ST]	P[ILMV].[LV][ST]	D.PL.L[ST]	QPL.L..K	P[IL].L[ST].[KR]	D.P.DL	P[IL]D.S	[DE].P[ILMV].L	[DE].P.[DE]L	QP[LV].[LV]	D..[IL]DL	[ILM]D[LV][ST]	P[ILMV].[LV][AS]	PLD.S	LDLS	D.P.DLS	D..LDLS	[ST]..DQP[LV]	Q..P[LMV]DL	P.DLS.{1,2}K	Q..P.DL.[LMV]	P.DL	Q..P.DL[ST]	P.DL..K.{0,2}R	P.DL[ST].K	P[IL]DL..[KR]	[DE].P.DL..[KR]	P.DL..[KR]	P.DL[ST]..[KR]	Q..P.DL	[IL]DLS.K	P.DL..K	P.DL..K[HR]	Q.L.{1,2}L..K	A..S..V[HK]..L	L..L.{1,2}N..K.K	A..S..V..[KR]L	Q.{0,2}P.DLS	A[IV].S..VK	(p = 0.00e+00)

SLiMMaker Consensus: 
- Unable to make a SLiM with these settings and peptides


Cloud 2 (3 SLiMs):	IK.E	[IV]K.[DE]P	[IV]K.E..[DE]	(p = 5.71e-05)

SLiMMaker Consensus: [IV]K.E[EKP]{0,1}
- SLiM matches 27 of 29 sequences (93.1%).


Cloud 3 (1 SLiMs):	G.{1,2}Y.C..C	(p = 0.002)
4 UPC	4 Seq:	EVI1_HUMAN__Q03112	IKZF4_HUMAN__Q9H2S9	ZEB1_HUMAN__P37275	ZFH1_DROME__P28166

SLiMMaker Consensus: G
- SLiM matches 4 of 4 sequences (100.0%).


Cloud 4 (1 SLiMs):	D.{1,2}RC.{0,1}K.R	(p = 0.021)
4 UPC	4 Seq:	CBX4_HUMAN__O00257	ZEB1_HUMAN__P37275	ZEB2_HUMAN__O60315	cbx4_XENLA__Q91647

SLiMMaker Consensus: D....K.R
- SLiM matches 4 of 4 sequences (100.0%).


#Cloud Seq coverage/overlap
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	1.000	1.000	1.000
2:IK.E	0.655	0.655	1.000	0.750	0.500
3:G.{1,2}Y.C..C	0.138	0.138	0.158	1.000	0.250
4:D.{1,2}RC.{0,1}K.R	0.138	0.138	0.105	0.250	1.000

#Probabilities of motif clouds overlapping Seq this much or more
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	0.792	0.791	0.791
2:IK.E	1.000	0.792	0.000	0.535	0.819
3:G.{1,2}Y.C..C	1.000	0.791	0.535	0.000	0.448
4:D.{1,2}RC.{0,1}K.R	1.000	0.791	0.819	0.448	0.000

#Probabilities of motif clouds overlapping Seq this little or less
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	0.785	0.815	0.815
2:IK.E	1.000	0.785	1.000	0.777	0.465
3:G.{1,2}Y.C..C	1.000	0.815	0.777	1.000	0.906
4:D.{1,2}RC.{0,1}K.R	1.000	0.815	0.465	0.906	1.000

#Cloud UPC coverage/overlap
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	1.000	1.000	1.000
2:IK.E	0.655	0.655	1.000	0.750	0.500
3:G.{1,2}Y.C..C	0.138	0.138	0.158	1.000	0.250
4:D.{1,2}RC.{0,1}K.R	0.138	0.138	0.105	0.250	1.000

#Probabilities of motif clouds overlapping UPC this much or more
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	0.792	0.791	0.791
2:IK.E	1.000	0.792	0.000	0.535	0.819
3:G.{1,2}Y.C..C	1.000	0.791	0.535	0.000	0.448
4:D.{1,2}RC.{0,1}K.R	1.000	0.791	0.819	0.448	0.000

#Probabilities of motif clouds overlapping UPC this little or less
Cloud	Dataset	1	2	3	4
1:P..C..C.[KR].[FY]	1.000	1.000	0.785	0.815	0.815
2:IK.E	1.000	0.785	1.000	0.777	0.465
3:G.{1,2}Y.C..C	1.000	0.815	0.777	1.000	0.906
4:D.{1,2}RC.{0,1}K.R	1.000	0.815	0.465	0.906	1.000

>CBX4_HUMAN__O00257 RecName: Full=E3 SUMO-protein ligase CBX4; EC=6.3.2.-; AltName: Full=Chromobox protein homolog 4; AltName: Full=Polycomb 2 homolog; Short=Pc2; Short=hPc2;
>COM1_HUMAN__Q99708 RecName: Full=DNA endonuclease RBBP8; EC=3.1.-.-; AltName: Full=CtBP-interacting protein; Short=CtIP; AltName: Full=Retinoblastoma-binding protein 8; Short=RBBP-8; AltName: Full=Retinoblastoma-interacting protein and myosin-like; Short=RIM; AltName: Full=Sporulation in the absence of SPO11 protein 2 homolog; Short=SAE2;
>E1A_ADE02__P03254 RecName: Full=Early E1A protein {ECO:0000305}; AltName: Full=Early E1A 32 kDa protein;
>ELK3_HUMAN__P41970 RecName: Full=ETS domain-containing protein Elk-3; AltName: Full=ETS-related protein ERP; AltName: Full=ETS-related protein NET; AltName: Full=Serum response factor accessory protein 2; Short=SAP-2; Short=SRF accessory protein 2;
>EVI1_HUMAN__Q03112 RecName: Full=MDS1 and EVI1 complex locus protein EVI1; AltName: Full=Ecotropic virus integration site 1 protein homolog; Short=EVI-1;
>FOG1_HUMAN__Q8IX07 RecName: Full=Zinc finger protein ZFPM1; AltName: Full=Friend of GATA protein 1; Short=FOG-1; Short=Friend of GATA 1; AltName: Full=Zinc finger protein 89A; AltName: Full=Zinc finger protein multitype 1;
>FOG2_HUMAN__Q8WW38 RecName: Full=Zinc finger protein ZFPM2; AltName: Full=Friend of GATA protein 2; Short=FOG-2; Short=Friend of GATA 2; Short=hFOG-2; AltName: Full=Zinc finger protein 89B; AltName: Full=Zinc finger protein multitype 2;
>HAIR_DROME__P14003 RecName: Full=Protein hairy;
>HDAC4_HUMAN__P56524 RecName: Full=Histone deacetylase 4; Short=HD4; EC=;
>HDAC5_HUMAN__Q9UQL6 RecName: Full=Histone deacetylase 5; Short=HD5; EC=; AltName: Full=Antigen NY-CO-9;
>HDAC9_MOUSE__Q99N13 RecName: Full=Histone deacetylase 9; Short=HD9; EC=; AltName: Full=Histone deacetylase 7B; Short=HD7b; AltName: Full=Histone deacetylase-related protein; AltName: Full=MEF2-interacting transcription repressor MITR;
>HDAC7_MOUSE__Q8C2B3 RecName: Full=Histone deacetylase 7; Short=HD7; EC=; AltName: Full=Histone deacetylase 7A; Short=HD7a;
>HIC1_HUMAN__Q14526 RecName: Full=Hypermethylated in cancer 1 protein; Short=Hic-1; AltName: Full=Zinc finger and BTB domain-containing protein 29;
>IKZF1_HUMAN__Q13422 RecName: Full=DNA-binding protein Ikaros; AltName: Full=Ikaros family zinc finger protein 1; AltName: Full=Lymphoid transcription factor LyF-1;
>IKZF4_HUMAN__Q9H2S9 RecName: Full=Zinc finger protein Eos; AltName: Full=Ikaros family zinc finger protein 4;
>KLF3_HUMAN__P57682 RecName: Full=Krueppel-like factor 3; AltName: Full=Basic krueppel-like factor; AltName: Full=CACCC-box-binding protein BKLF; AltName: Full=TEF-2;
>KLF8_HUMAN__O95600 RecName: Full=Krueppel-like factor 8; AltName: Full=Basic krueppel-like factor 3; AltName: Full=Zinc finger protein 741;
>KNIR_DROME__P10734 RecName: Full=Zygotic gap protein knirps; AltName: Full=Nuclear receptor subfamily 0 group A member 1;
>LCOR_HUMAN__Q96JN0 RecName: Full=Ligand-dependent corepressor; Short=LCoR; AltName: Full=Mblk1-related protein 2;
>NRIP1_HUMAN__P48552 RecName: Full=Nuclear receptor-interacting protein 1; AltName: Full=Nuclear factor RIP140; AltName: Full=Receptor-interacting protein 140;
>SOX6_HUMAN__P35712 RecName: Full=Transcription factor SOX-6;
>T7L1A_XENLA__P70062 RecName: Full=Transcription factor 7-like 1-A; AltName: Full=HMG box transcription factor 3-A; Short=TCF-3-A; Short=xTcf-3;
>TGIF1_HUMAN__Q15583 RecName: Full=Homeobox protein TGIF1; AltName: Full=5'-TG-3'-interacting factor 1;
>TRPS1_HUMAN__Q9UHF7 RecName: Full=Zinc finger transcription factor Trps1; AltName: Full=Tricho-rhino-phalangeal syndrome type I protein; AltName: Full=Zinc finger protein GC79;
>TTKB_DROME__P17789 RecName: Full=Protein tramtrack, beta isoform; AltName: Full=Repressor protein fushi tarazu; AltName: Full=Tramtrack p69;
>ZEB1_HUMAN__P37275 RecName: Full=Zinc finger E-box-binding homeobox 1; AltName: Full=NIL-2-A zinc finger protein; AltName: Full=Negative regulator of IL2; AltName: Full=Transcription factor 8; Short=TCF-8;
>ZEB2_HUMAN__O60315 RecName: Full=Zinc finger E-box-binding homeobox 2; AltName: Full=Smad-interacting protein 1; Short=SMADIP1; AltName: Full=Zinc finger homeobox protein 1b;
>ZFH1_DROME__P28166 RecName: Full=Zinc finger protein 1; AltName: Full=Zinc finger homeodomain protein 1;
>cbx4_XENLA__Q91647 SubName: Full=XPolycomb {ECO:0000313|EMBL:AAC59728.1};
>CBX4_HUMAN__O00257-slimfinder Motifs
>CBX4_HUMAN__O00257 RecName: Full=E3 SUMO-protein ligase CBX4; EC=6.3.2.-; AltName: Full=Chromobox protein homolog 4; AltName: Full=Polycomb 2 homolog; Short=Pc2; Short=hPc2;
>COM1_HUMAN__Q99708-slimfinder Motifs
>COM1_HUMAN__Q99708 RecName: Full=DNA endonuclease RBBP8; EC=3.1.-.-; AltName: Full=CtBP-interacting protein; Short=CtIP; AltName: Full=Retinoblastoma-binding protein 8; Short=RBBP-8; AltName: Full=Retinoblastoma-interacting protein and myosin-like; Short=RIM; AltName: Full=Sporulation in the absence of SPO11 protein 2 homolog; Short=SAE2;
>E1A_ADE02__P03254-slimfinder Motifs
>E1A_ADE02__P03254 RecName: Full=Early E1A protein {ECO:0000305}; AltName: Full=Early E1A 32 kDa protein;
>ELK3_HUMAN__P41970-slimfinder Motifs
>ELK3_HUMAN__P41970 RecName: Full=ETS domain-containing protein Elk-3; AltName: Full=ETS-related protein ERP; AltName: Full=ETS-related protein NET; AltName: Full=Serum response factor accessory protein 2; Short=SAP-2; Short=SRF accessory protein 2;
>EVI1_HUMAN__Q03112-slimfinder Motifs
>EVI1_HUMAN__Q03112 RecName: Full=MDS1 and EVI1 complex locus protein EVI1; AltName: Full=Ecotropic virus integration site 1 protein homolog; Short=EVI-1;
>FOG1_HUMAN__Q8IX07-slimfinder Motifs
>FOG1_HUMAN__Q8IX07 RecName: Full=Zinc finger protein ZFPM1; AltName: Full=Friend of GATA protein 1; Short=FOG-1; Short=Friend of GATA 1; AltName: Full=Zinc finger protein 89A; AltName: Full=Zinc finger protein multitype 1;
>FOG2_HUMAN__Q8WW38-slimfinder Motifs
>FOG2_HUMAN__Q8WW38 RecName: Full=Zinc finger protein ZFPM2; AltName: Full=Friend of GATA protein 2; Short=FOG-2; Short=Friend of GATA 2; Short=hFOG-2; AltName: Full=Zinc finger protein 89B; AltName: Full=Zinc finger protein multitype 2;
>HAIR_DROME__P14003-slimfinder Motifs
>HAIR_DROME__P14003 RecName: Full=Protein hairy;
>HDAC4_HUMAN__P56524-slimfinder Motifs
>HDAC4_HUMAN__P56524 RecName: Full=Histone deacetylase 4; Short=HD4; EC=;
>HDAC5_HUMAN__Q9UQL6-slimfinder Motifs
>HDAC5_HUMAN__Q9UQL6 RecName: Full=Histone deacetylase 5; Short=HD5; EC=; AltName: Full=Antigen NY-CO-9;
>HDAC9_MOUSE__Q99N13-slimfinder Motifs
>HDAC9_MOUSE__Q99N13 RecName: Full=Histone deacetylase 9; Short=HD9; EC=; AltName: Full=Histone deacetylase 7B; Short=HD7b; AltName: Full=Histone deacetylase-related protein; AltName: Full=MEF2-interacting transcription repressor MITR;
>HDAC7_MOUSE__Q8C2B3-slimfinder Motifs
>HDAC7_MOUSE__Q8C2B3 RecName: Full=Histone deacetylase 7; Short=HD7; EC=; AltName: Full=Histone deacetylase 7A; Short=HD7a;
>HIC1_HUMAN__Q14526-slimfinder Motifs
>HIC1_HUMAN__Q14526 RecName: Full=Hypermethylated in cancer 1 protein; Short=Hic-1; AltName: Full=Zinc finger and BTB domain-containing protein 29;
>IKZF1_HUMAN__Q13422-slimfinder Motifs
>IKZF1_HUMAN__Q13422 RecName: Full=DNA-binding protein Ikaros; AltName: Full=Ikaros family zinc finger protein 1; AltName: Full=Lymphoid transcription factor LyF-1;
>IKZF4_HUMAN__Q9H2S9-slimfinder Motifs
>IKZF4_HUMAN__Q9H2S9 RecName: Full=Zinc finger protein Eos; AltName: Full=Ikaros family zinc finger protein 4;
>KLF3_HUMAN__P57682-slimfinder Motifs
>KLF3_HUMAN__P57682 RecName: Full=Krueppel-like factor 3; AltName: Full=Basic krueppel-like factor; AltName: Full=CACCC-box-binding protein BKLF; AltName: Full=TEF-2;
>KLF8_HUMAN__O95600-slimfinder Motifs
>KLF8_HUMAN__O95600 RecName: Full=Krueppel-like factor 8; AltName: Full=Basic krueppel-like factor 3; AltName: Full=Zinc finger protein 741;
>KNIR_DROME__P10734-slimfinder Motifs
>KNIR_DROME__P10734 RecName: Full=Zygotic gap protein knirps; AltName: Full=Nuclear receptor subfamily 0 group A member 1;
>LCOR_HUMAN__Q96JN0-slimfinder Motifs
>LCOR_HUMAN__Q96JN0 RecName: Full=Ligand-dependent corepressor; Short=LCoR; AltName: Full=Mblk1-related protein 2;
>NRIP1_HUMAN__P48552-slimfinder Motifs
>NRIP1_HUMAN__P48552 RecName: Full=Nuclear receptor-interacting protein 1; AltName: Full=Nuclear factor RIP140; AltName: Full=Receptor-interacting protein 140;
>SOX6_HUMAN__P35712-slimfinder Motifs
>SOX6_HUMAN__P35712 RecName: Full=Transcription factor SOX-6;
>T7L1A_XENLA__P70062-slimfinder Motifs
>T7L1A_XENLA__P70062 RecName: Full=Transcription factor 7-like 1-A; AltName: Full=HMG box transcription factor 3-A; Short=TCF-3-A; Short=xTcf-3;
>TGIF1_HUMAN__Q15583-slimfinder Motifs
>TGIF1_HUMAN__Q15583 RecName: Full=Homeobox protein TGIF1; AltName: Full=5'-TG-3'-interacting factor 1;
>TRPS1_HUMAN__Q9UHF7-slimfinder Motifs
>TRPS1_HUMAN__Q9UHF7 RecName: Full=Zinc finger transcription factor Trps1; AltName: Full=Tricho-rhino-phalangeal syndrome type I protein; AltName: Full=Zinc finger protein GC79;
>TTKB_DROME__P17789-slimfinder Motifs
>TTKB_DROME__P17789 RecName: Full=Protein tramtrack, beta isoform; AltName: Full=Repressor protein fushi tarazu; AltName: Full=Tramtrack p69;
>ZEB1_HUMAN__P37275-slimfinder Motifs
>ZEB1_HUMAN__P37275 RecName: Full=Zinc finger E-box-binding homeobox 1; AltName: Full=NIL-2-A zinc finger protein; AltName: Full=Negative regulator of IL2; AltName: Full=Transcription factor 8; Short=TCF-8;
>ZEB2_HUMAN__O60315-slimfinder Motifs
>ZEB2_HUMAN__O60315 RecName: Full=Zinc finger E-box-binding homeobox 2; AltName: Full=Smad-interacting protein 1; Short=SMADIP1; AltName: Full=Zinc finger homeobox protein 1b;
>ZFH1_DROME__P28166-slimfinder Motifs
>ZFH1_DROME__P28166 RecName: Full=Zinc finger protein 1; AltName: Full=Zinc finger homeodomain protein 1;
>cbx4_XENLA__Q91647-slimfinder Motifs
>cbx4_XENLA__Q91647 SubName: Full=XPolycomb {ECO:0000313|EMBL:AAC59728.1};
slimfinder.l5w2o2a3.CtBP-NoEFilter.motifaln.fas is too large to return (6.47 MB > 1 MB) in full output. Try[&password=X].
slimfinder.l5w2o2a3.CtBP-NoEFilter.maskaln.fas is too large to return (6.47 MB > 1 MB) in full output. Try[&password=X].
ID   CBX4_HUMAN              Reviewed;         560 AA.
AC   O00257; B1PJR7; Q6TPI8; Q96C04;
DT   24-JAN-2001, integrated into UniProtKB/Swiss-Prot.
DT   28-JUL-2009, sequence version 3.
DT   11-NOV-2015, entry version 153.
DE   RecName: Full=E3 SUMO-protein ligase CBX4;
DE            EC=6.3.2.-;
DE   AltName: Full=Chromobox protein homolog 4;
DE   AltName: Full=Polycomb 2 homolog;
DE            Short=Pc2;
DE            Short=hPc2;
GN   Name=CBX4;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Fetal brain;
RX   PubMed=9315667;
RA   Satijn D.P.E., Olson D.J., van der Vlag J., Hamer K.M., Lambrechts C.,
RA   Masselink H., Gunster M.J., Sewalt R.G.A.B., van Driel R., Otte A.P.;
RT   "Interference with the expression of a novel human polycomb protein,
RT   hPc2, results in cellular transformation and apoptosis.";
RL   Mol. Cell. Biol. 17:6076-6086(1997).
RN   [2]
RX   PubMed=19266028; DOI=10.1371/journal.pgen.1000397;
RA   Salichs E., Ledda A., Mularoni L., Alba M.M., de la Luna S.;
RT   "Genome-wide analysis of histidine repeats reveals their role in the
RT   localization of human proteins to the nuclear speckles compartment.";
RL   PLoS Genet. 5:E1000397-E1000397(2009).
RN   [3]
RA   Liu M., Cheng J., Wang L.;
RT   "Cloning and identification of NS5ATP1-binding protein 16.";
RL   Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RX   PubMed=16625196; DOI=10.1038/nature04689;
RA   Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R.,
RA   Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A.,
RA   Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J.,
RA   Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J.,
RA   DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R.,
RA   Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N.,
RA   Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B.,
RA   Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J.,
RA   Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E.,
RA   Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J.,
RA   Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C.,
RA   Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D.,
RA   Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A.,
RA   Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.;
RT   "DNA sequence of human chromosome 17 and analysis of rearrangement in
RT   the human lineage.";
RL   Nature 440:1045-1049(2006).
RN   [5]
RC   TISSUE=Colon;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [6]
RX   PubMed=9199346;
RA   Satijn D.P.E., Gunster M.J., van der Vlag J., Hamer K.M., Schul W.,
RA   Alkema M.J., Saurin A.J., Freemont P.S., van Driel R., Otte A.P.;
RT   "RING1 is associated with the polycomb group protein complex and acts
RT   as a transcriptional repressor.";
RL   Mol. Cell. Biol. 17:4105-4113(1997).
RN   [7]
RX   PubMed=12101246; DOI=10.1128/MCB.22.15.5539-5553.2002;
RA   Sewalt R.G.A.B., Lachner M., Vargas M., Hamer K.M., den Blaauwen J.L.,
RA   Hendrix T., Melcher M., Schweizer D., Jenuwein T., Otte A.P.;
RT   "Selective interactions between vertebrate polycomb homologs and the
RT   SUV39H1 histone lysine methyltransferase suggest that histone H3-K9
RT   methylation contributes to chromosomal targeting of Polycomb group
RT   proteins.";
RL   Mol. Cell. Biol. 22:5539-5553(2002).
RN   [8]
RP   RNF2.
RX   PubMed=12167701; DOI=10.1128/MCB.22.17.6070-6078.2002;
RA   Levine S.S., Weiss A., Erdjument-Bromage H., Shao Z., Tempst P.,
RA   Kingston R.E.;
RT   "The core of the polycomb repressive complex is compositionally and
RT   functionally conserved in flies and humans.";
RL   Mol. Cell. Biol. 22:6070-6078(2002).
RN   [9]
RX   PubMed=12679040; DOI=10.1016/S0092-8674(03)00159-4;
RA   Kagey M.H., Melhuish T.A., Wotton D.;
RT   "The polycomb protein Pc2 is a SUMO E3.";
RL   Cell 113:127-137(2003).
RN   [10]
RX   PubMed=15592428; DOI=10.1038/sj.emboj.7600506;
RA   Kagey M.H., Melhuish T.A., Powers S.E., Wotton D.;
RT   "Multiple activities contribute to Pc2 E3 function.";
RL   EMBO J. 24:108-119(2005).
RN   [11]
RX   PubMed=16061479; DOI=10.1074/jbc.M504477200;
RA   Long J., Zuo D., Park M.;
RT   "Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates
RT   transcriptional repression of E-cadherin.";
RL   J. Biol. Chem. 280:35477-35489(2005).
RN   [12]
RX   PubMed=17018294; DOI=10.1016/j.molcel.2006.08.004;
RA   Roscic A., Moeller A., Calzado M.A., Renner F., Wimmer V.C.,
RA   Gresko E., Luedi K.S., Schmitz M.L.;
RT   "Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by
RT   its substrate protein HIPK2.";
RL   Mol. Cell 24:77-89(2006).
RN   [13]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=18669648; DOI=10.1073/pnas.0805139105;
RA   Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
RA   Elledge S.J., Gygi S.P.;
RT   "A quantitative atlas of mitotic phosphorylation.";
RL   Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
RN   [14]
RX   PubMed=19636380; DOI=10.1371/journal.pone.0006380;
RA   Maertens G.N., El Messaoudi-Aubert S., Racek T., Stock J.K.,
RA   Nicholls J., Rodriguez-Niedenfuhr M., Gil J., Peters G.;
RT   "Several distinct polycomb complexes regulate and co-localize on the
RT   INK4a tumor suppressor locus.";
RL   PLoS ONE 4:E6380-E6380(2009).
RN   [15]
RX   PubMed=19608861; DOI=10.1126/science.1175371;
RA   Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M.,
RA   Walther T.C., Olsen J.V., Mann M.;
RT   "Lysine acetylation targets protein complexes and co-regulates major
RT   cellular functions.";
RL   Science 325:834-840(2009).
RN   [16]
RX   PubMed=21282530; DOI=10.1074/mcp.M110.002642;
RA   Vandamme J., Volkel P., Rosnoblet C., Le Faou P., Angrand P.O.;
RT   "Interaction proteomics analysis of polycomb proteins defines distinct
RT   PRC1 Complexes in mammalian cells.";
RL   Mol. Cell. Proteomics 0:0-0(2011).
RN   [17]
RP   OF LYS-494 AND THR-497.
RX   PubMed=22467880; DOI=10.1074/jbc.M111.336354;
RA   Oh Y., Chung K.C.;
RT   "Small ubiquitin-like modifier (SUMO) modification of zinc finger
RT   protein 131 potentiates its negative effect on estrogen signaling.";
RL   J. Biol. Chem. 287:17517-17529(2012).
RN   [18]
RX   PubMed=22825850; DOI=10.1074/jbc.M112.390120;
RA   Pelisch F., Pozzi B., Risso G., Munoz M.J., Srebrow A.;
RT   "DNA damage-induced heterogeneous nuclear ribonucleoprotein K
RT   SUMOylation regulates p53 transcriptional activation.";
RL   J. Biol. Chem. 287:30789-30799(2012).
RN   [19]
RC   TISSUE=Liver;
RX   PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
RA   Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
RA   Wang L., Ye M., Zou H.;
RT   "An enzyme assisted RP-RPLC approach for in-depth analysis of human
RT   liver phosphoproteome.";
RL   J. Proteomics 96:253-262(2014).
RN   [20]
RX   PubMed=25218447; DOI=10.1038/nsmb.2890;
RA   Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M.,
RA   Vertegaal A.C.;
RT   "Uncovering global SUMOylation signaling networks in a site-specific
RT   manner.";
RL   Nat. Struct. Mol. Biol. 21:927-936(2014).
RN   [21]
RG   Structural genomics consortium (SGC);
RT   "Solution NMR structure of the chromo domain of the chromobox protein
RT   homolog 4.";
RL   Submitted (FEB-2009) to the PDB data bank.
RN   [22]
RG   Structural genomics consortium (SGC);
RT   "Crystal structure of human chromobox homolog 4 (cbx4).";
RL   Submitted (SEP-2009) to the PDB data bank.
CC   -!- FUNCTION: E3 SUMO-protein ligase which facilitates SUMO1
CC       conjugation by UBE2I. Involved in the sumoylation of HNRNPK, a
CC       p53/TP53 transcriptional coactivator, hence indirectly regulates
CC       p53/TP53 transcriptional activation resulting in p21/CDKN1A
CC       expression. Monosumoylates ZNF131.
CC   -!- FUNCTION: Component of a Polycomb group (PcG) multiprotein PRC1-
CC       like complex, a complex class required to maintain the
CC       transcriptionally repressive state of many genes, including Hox
CC       genes, throughout development. PcG PRC1 complex acts via chromatin
CC       remodeling and modification of histones; it mediates
CC       monoubiquitination of histone H2A 'Lys-119', rendering chromatin
CC       heritably changed in its expressibility.
CC   -!- PATHWAY: Protein modification; protein sumoylation.
CC   -!- SUBUNIT: Interacts with histone H3-K9Me3. Interacts with CHTOP (By
CC       similarity). Component of a PRC1-like complex. Self-associates.
CC       Interacts with SUV39H1 and HIPK2. Interacts with CSNK2B.
CC       {ECO:0000250, ECO:0000269|PubMed:12101246,
CC       ECO:0000269|PubMed:12167701, ECO:0000269|PubMed:17018294,
CC       ECO:0000269|PubMed:19636380, ECO:0000269|PubMed:21282530}.
CC       P35226:BMI1; NbExp=4; IntAct=EBI-722425, EBI-2341576;
CC       P68400:CSNK2A1; NbExp=2; IntAct=EBI-4392727, EBI-347804;
CC       P67870:CSNK2B; NbExp=2; IntAct=EBI-4392727, EBI-348169;
CC       Q16665:HIF1A; NbExp=15; IntAct=EBI-722425, EBI-447269;
CC       Q9BYE7:PCGF6; NbExp=2; IntAct=EBI-4392727, EBI-1048026;
CC       Q99496:RNF2; NbExp=2; IntAct=EBI-4392727, EBI-722416;
CC       P31946:YWHAB; NbExp=2; IntAct=EBI-722425, EBI-359815;
CC       P62258:YWHAE; NbExp=2; IntAct=EBI-4392727, EBI-356498;
CC       P63104:YWHAZ; NbExp=2; IntAct=EBI-4392727, EBI-347088;
CC   -!- SUBCELLULAR LOCATION: Nucleus. Nucleus speckle. Note=Localization
CC       to nuclear polycomb bodies is required for ZNF131 sumoylation.
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=O00257-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=O00257-3; Sequence=VSP_041599;
CC   -!- TISSUE SPECIFICITY: Ubiquitous.
CC   -!- DOMAIN: The polyhistidine repeat may act as a targeting signal to
CC       nuclear speckles. {ECO:0000269|PubMed:19266028}.
CC   -!- PTM: Phosphorylated on Thr-497 by HIPK2 upon DNA damage. This
CC       phosphorylation stimulates E3 SUMO-protein ligase activity and
CC       promotes sumoylation on Lys-494, as well as sumoylation of other
CC       target proteins, such as HNRNPK. {ECO:0000269|PubMed:12679040,
CC       ECO:0000269|PubMed:15592428, ECO:0000269|PubMed:17018294}.
CC   -!- MISCELLANEOUS: The human orthologs of the Drosophila Polycomb
CC       group protein Pc are CBX2, CBX4, CBX6, CBX7 and CBX8. These show
CC       distinct nuclear localizations, contribute differently to
CC       transcriptional repression, and appear to be part of distinct
CC       PRC1-like protein complexes. The hPRC-H complex purified in
CC       PubMed:12167701 probably presents a mixture of different complexes
CC       containing different Polycomb group proteins.
CC   -!- SIMILARITY: Contains 1 chromo domain. {ECO:0000255|PROSITE-
CC       ProRule:PRU00053}.
CC       Sequence=AAH14967.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF013956; AAB80718.1; -; mRNA.
DR   EMBL; EU439707; ACA49234.1; -; mRNA.
DR   EMBL; AY390430; AAQ97596.1; -; mRNA.
DR   EMBL; AC100791; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC014967; AAH14967.1; ALT_SEQ; mRNA.
DR   EMBL; U94344; AAB62734.1; -; mRNA.
DR   CCDS; CCDS32758.1; -. [O00257-1]
DR   RefSeq; NP_003646.2; NM_003655.2. [O00257-1]
DR   UniGene; Hs.405046; -.
DR   PDB; 2K28; NMR; -; A=8-65.
DR   PDB; 3I8Z; X-ray; 1.51 A; A=8-62.
DR   PDBsum; 2K28; -.
DR   PDBsum; 3I8Z; -.
DR   ProteinModelPortal; O00257; -.
DR   SMR; O00257; 11-60.
DR   BioGrid; 114105; 75.
DR   DIP; DIP-42042N; -.
DR   IntAct; O00257; 47.
DR   MINT; MINT-1196265; -.
DR   STRING; 9606.ENSP00000269397; -.
DR   BindingDB; O00257; -.
DR   ChEMBL; CHEMBL3232685; -.
DR   PhosphoSite; O00257; -.
DR   BioMuta; CBX4; -.
DR   MaxQB; O00257; -.
DR   PaxDb; O00257; -.
DR   PRIDE; O00257; -.
DR   Ensembl; ENST00000269397; ENSP00000269397; ENSG00000141582. [O00257-1]
DR   GeneID; 8535; -.
DR   KEGG; hsa:8535; -.
DR   UCSC; uc002jxe.3; human. [O00257-1]
DR   CTD; 8535; -.
DR   GeneCards; CBX4; -.
DR   H-InvDB; HIX0014237; -.
DR   HGNC; HGNC:1554; CBX4.
DR   HPA; HPA008228; -.
DR   MIM; 603079; gene.
DR   neXtProt; NX_O00257; -.
DR   PharmGKB; PA26129; -.
DR   eggNOG; ENOG410IPQ6; Eukaryota.
DR   GeneTree; ENSGT00530000063056; -.
DR   HOGENOM; HOG000206923; -.
DR   HOVERGEN; HBG005257; -.
DR   InParanoid; O00257; -.
DR   KO; K11452; -.
DR   OrthoDB; EOG7PCJGP; -.
DR   PhylomeDB; O00257; -.
DR   TreeFam; TF106456; -.
DR   Reactome; R-HSA-2559580; Oxidative Stress Induced Senescence.
DR   Reactome; R-HSA-3108214; SUMOylation of DNA damage response and repair proteins.
DR   UniPathway; UPA00886; -.
DR   ChiTaRS; CBX4; human.
DR   EvolutionaryTrace; O00257; -.
DR   GenomeRNAi; 8535; -.
DR   NextBio; 31968; -.
DR   PRO; PR:O00257; -.
DR   Proteomes; UP000005640; Chromosome 17.
DR   Bgee; O00257; -.
DR   CleanEx; HS_CBX4; -.
DR   ExpressionAtlas; O00257; baseline and differential.
DR   Genevisible; O00257; HS.
DR   GO; GO:0016607; C:nuclear speck; IEA:UniProtKB-SubCell.
DR   GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
DR   GO; GO:0005634; C:nucleus; IDA:UniProtKB.
DR   GO; GO:0031519; C:PcG protein complex; IDA:UniProtKB.
DR   GO; GO:0035102; C:PRC1 complex; IDA:UniProtKB.
DR   GO; GO:0003682; F:chromatin binding; IEA:Ensembl.
DR   GO; GO:0019899; F:enzyme binding; IPI:UniProtKB.
DR   GO; GO:0016874; F:ligase activity; IEA:UniProtKB-KW.
DR   GO; GO:0003727; F:single-stranded RNA binding; IEA:Ensembl.
DR   GO; GO:0032183; F:SUMO binding; IDA:MGI.
DR   GO; GO:0019789; F:SUMO transferase activity; EXP:Reactome.
DR   GO; GO:0003714; F:transcription corepressor activity; TAS:ProtInc.
DR   GO; GO:0044212; F:transcription regulatory region DNA binding; IEA:Ensembl.
DR   GO; GO:0044267; P:cellular protein metabolic process; TAS:Reactome.
DR   GO; GO:0016568; P:chromatin modification; IEA:UniProtKB-KW.
DR   GO; GO:0043066; P:negative regulation of apoptotic process; TAS:ProtInc.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IMP:UniProtKB.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
DR   GO; GO:0043687; P:post-translational protein modification; TAS:Reactome.
DR   GO; GO:0016925; P:protein sumoylation; TAS:Reactome.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   InterPro; IPR000953; Chromo/shadow_dom.
DR   InterPro; IPR017984; Chromo_dom_subgr.
DR   InterPro; IPR023780; Chromo_domain.
DR   InterPro; IPR016197; Chromodomain-like.
DR   InterPro; IPR023779; Chromodomain_CS.
DR   Pfam; PF00385; Chromo; 1.
DR   SMART; SM00298; CHROMO; 1.
DR   SUPFAM; SSF54160; SSF54160; 1.
DR   PROSITE; PS00598; CHROMO_1; 1.
DR   PROSITE; PS50013; CHROMO_2; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Acetylation; Alternative splicing; Chromatin regulator;
KW   Complete proteome; Isopeptide bond; Ligase; Nucleus; Phosphoprotein;
KW   Reference proteome; Repressor; Transcription;
KW   Transcription regulation; Ubl conjugation; Ubl conjugation pathway.
FT   CHAIN         1    560       E3 SUMO-protein ligase CBX4.
FT                                /FTId=PRO_0000080206.
FT   DOMAIN       11     69       Chromo. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00053}.
FT   REGION        1    539       Interaction with BMI1.
FT   REGION      540    560       Interaction with RNF2.
FT   COMPBIAS    378    400       His-rich.
FT   COMPBIAS    389    400       Poly-His.
FT   COMPBIAS    499    510       Poly-Ala.
FT   MOD_RES     149    149       N6-acetyllysine; alternate.
FT                                {ECO:0000244|PubMed:19608861}.
FT   MOD_RES     467    467       Phosphoserine.
FT                                {ECO:0000244|PubMed:24275569}.
FT   MOD_RES     497    497       Phosphothreonine; by HIPK2.
FT                                {ECO:0000269|PubMed:17018294}.
FT   CROSSLNK    106    106       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    114    114       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    149    149       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2);
FT                                alternate. {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    205    205       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    212    212       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    280    280       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    494    494       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO).
FT   VAR_SEQ     127    396       Missing (in isoform 2).
FT                                {ECO:0000303|Ref.3}.
FT                                /FTId=VSP_041599.
FT   MUTAGEN     434    434       S->A: Abolishes interaction with YWHAZ
FT                                and YWHAE; impairs interaction with PCGF6
FT                                and BMI1; no effect on interaction with
FT                                RNF2. {ECO:0000269|PubMed:21282530}.
FT   MUTAGEN     494    494       K->R: No effect on ZNF131 sumoylation.
FT                                {ECO:0000269|PubMed:22467880}.
FT   MUTAGEN     497    497       T->A: Small decrease in ZNF131
FT                                sumoylation.
FT                                {ECO:0000269|PubMed:22467880}.
FT   CONFLICT    137    138       Missing (in Ref. 1; AAB80718).
FT                                {ECO:0000305}.
FT   CONFLICT    142    142       P -> R (in Ref. 1; AAB80718).
FT                                {ECO:0000305}.
FT   CONFLICT    458    458       P -> R (in Ref. 1; AAB80718 and 5;
FT                                AAB62734). {ECO:0000305}.
FT   CONFLICT    477    477       C -> S (in Ref. 1; AAB80718 and 5;
FT                                AAB62734). {ECO:0000305}.
FT   CONFLICT    480    480       T -> S (in Ref. 1; AAB80718 and 5;
FT                                AAB62734). {ECO:0000305}.
FT   CONFLICT    505    505       V -> VAA (in Ref. 3; ACA49234).
FT                                {ECO:0000305}.
FT   STRAND       13     22       {ECO:0000244|PDB:3I8Z}.
FT   STRAND       25     32       {ECO:0000244|PDB:3I8Z}.
FT   HELIX        37     39       {ECO:0000244|PDB:3I8Z}.
FT   STRAND       41     44       {ECO:0000244|PDB:3I8Z}.
FT   HELIX        45     48       {ECO:0000244|PDB:3I8Z}.
FT   HELIX        51     53       {ECO:0000244|PDB:3I8Z}.
SQ   SEQUENCE   560 AA;  61368 MW;  DF5C8C4C0CCB1F31 CRC64;
ID   COM1_HUMAN              Reviewed;         897 AA.
AC   Q99708; A6NKN2; A8K8W6; E7ETY1; O75371; Q8NHQ3;
DT   01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
DT   17-OCT-2006, sequence version 2.
DT   11-NOV-2015, entry version 147.
DE   RecName: Full=DNA endonuclease RBBP8;
DE            EC=3.1.-.-;
DE   AltName: Full=CtBP-interacting protein;
DE            Short=CtIP;
DE   AltName: Full=Retinoblastoma-binding protein 8;
DE            Short=RBBP-8;
DE   AltName: Full=Retinoblastoma-interacting protein and myosin-like;
DE            Short=RIM;
DE   AltName: Full=Sporulation in the absence of SPO11 protein 2 homolog;
DE            Short=SAE2;
GN   Name=RBBP8; Synonyms=CTIP;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RX   PubMed=9721205; DOI=10.1006/geno.1998.5368;
RA   Fusco C., Reymond A., Zervos A.S.;
RT   "Molecular cloning and characterization of a novel retinoblastoma-
RT   binding protein.";
RL   Genomics 51:351-358(1998).
RN   [2]
RX   PubMed=9535825; DOI=10.1074/jbc.273.15.8549;
RA   Schaeper U., Subramanian T., Lim L., Boyd J.M., Chinnadurai G.;
RT   "Interaction between a cellular protein that binds to the C-terminal
RT   region of adenovirus E1A (CtBP) and a novel cellular protein is
RT   disrupted by E1A through a conserved PLDLS motif.";
RL   J. Biol. Chem. 273:8549-8552(1998).
RN   [3]
RC   TISSUE=Testis;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [4]
RC   TISSUE=Endometrial cancer;
RX   PubMed=17974005; DOI=10.1186/1471-2164-8-399;
RA   Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
RA   Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
RA   Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
RA   Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
RT   "The full-ORF clone resource of the German cDNA consortium.";
RL   BMC Genomics 8:399-399(2007).
RN   [5]
RX   PubMed=16177791; DOI=10.1038/nature03983;
RA   Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D.,
RA   Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K.,
RA   FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S.,
RA   Bloom T., Bugalter B., Butler J., Cook A., DeCaprio D., Engels R.,
RA   Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T.,
RA   Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E.,
RA   Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H.,
RA   O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K.,
RA   Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R.,
RA   Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.;
RT   "DNA sequence and analysis of human chromosome 18.";
RL   Nature 437:551-555(2005).
RN   [6]
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [7]
RC   TISSUE=Testis;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [8]
RX   PubMed=10764811; DOI=10.1074/jbc.M909494199;
RA   Yu X., Baer R.;
RT   "Nuclear localization and cell cycle-specific expression of CtIP, a
RT   protein that associates with the BRCA1 tumor suppressor.";
RL   J. Biol. Chem. 275:18541-18549(2000).
RN   [9]
RP   SER-664 AND SER-745.
RX   PubMed=10910365; DOI=10.1038/35018134;
RA   Li S., Ting N.S.Y., Zheng L., Chen P.-L., Ziv Y., Shiloh Y.,
RA   Lee E.Y.-H.P., Lee W.-H.;
RT   "Functional link of BRCA1 and ataxia telangiectasia gene product in
RT   DNA damage response.";
RL   Nature 406:210-215(2000).
RN   [10]
RX   PubMed=11751867; DOI=10.1074/jbc.M110603200;
RA   Sum E.Y., Peng B., Yu X., Chen J., Byrne J., Lindeman G.J.,
RA   Visvader J.E.;
RT   "The LIM domain protein LMO4 interacts with the cofactor CtIP and the
RT   tumor suppressor BRCA1 and inhibits BRCA1 activity.";
RL   J. Biol. Chem. 277:7849-7856(2002).
RN   [11]
RX   PubMed=14654780; DOI=10.1038/sj.onc.1206994;
RA   Germani A., Prabel A., Mourah S., Podgorniak M.-P., Di Carlo A.,
RA   Ehrlich R., Gisselbrecht S., Varin-Blank N., Calvo F.,
RA   Bruzzoni-Giovanelli H.;
RT   "SIAH-1 interacts with CtIP and promotes its degradation by the
RT   proteasome pathway.";
RL   Oncogene 22:8845-8851(2003).
RN   [12]
RX   PubMed=15084581; DOI=10.1074/jbc.M313974200;
RA   Dubin M.J., Stokes P.H., Sum E.Y., Williams R.S., Valova V.A.,
RA   Robinson P.J., Lindeman G.J., Glover J.N., Visvader J.E.,
RA   Matthews J.M.;
RT   "Dimerization of CtIP, a BRCA1- and CtBP-interacting protein, is
RT   mediated by an N-terminal coiled-coil motif.";
RL   J. Biol. Chem. 279:26932-26938(2004).
RN   [13]
RX   PubMed=15485915; DOI=10.1128/MCB.24.21.9478-9486.2004;
RA   Yu X., Chen J.;
RT   "DNA damage-induced cell cycle checkpoint control requires CtIP, a
RT   phosphorylation-dependent binding partner of BRCA1 C-terminal
RT   domains.";
RL   Mol. Cell. Biol. 24:9478-9486(2004).
RN   [14]
RP   SER-327.
RX   PubMed=16818604; DOI=10.1101/gad.1431006;
RA   Yu X., Fu S., Lai M., Baer R., Chen J.;
RT   "BRCA1 ubiquitinates its phosphorylation-dependent binding partner
RT   CtIP.";
RL   Genes Dev. 20:1721-1726(2006).
RN   [15]
RX   PubMed=16581787; DOI=10.1128/MCB.26.8.3124-3134.2006;
RA   Liu F., Lee W.H.;
RT   "CtIP activates its own and cyclin D1 promoters via the E2F/RB pathway
RT   during G1/S progression.";
RL   Mol. Cell. Biol. 26:3124-3134(2006).
RN   [16]
RX   PubMed=17965729; DOI=10.1038/nature06337;
RA   Sartori A.A., Lukas C., Coates J., Mistrik M., Fu S., Bartek J.,
RA   Baer R., Lukas J., Jackson S.P.;
RT   "Human CtIP promotes DNA end resection.";
RL   Nature 450:509-514(2007).
RN   [17]
RX   PubMed=19270026; DOI=10.1093/hmg/ddp107;
RA   Quaye L., Dafou D., Ramus S.J., Song H., Gentry-Maharaj A.,
RA   Notaridou M., Hogdall E., Kjaer S.K., Christensen L., Hogdall C.,
RA   Easton D.F., Jacobs I., Menon U., Pharoah P.D., Gayther S.A.;
RT   "Functional complementation studies identify candidate genes and
RT   common genetic variants associated with ovarian cancer survival.";
RL   Hum. Mol. Genet. 18:1869-1878(2009).
RN   [18]
RP   THR-847.
RX   PubMed=19202191; DOI=10.1074/jbc.M808906200;
RA   Huertas P., Jackson S.P.;
RT   "Human CtIP mediates cell cycle control of DNA end resection and
RT   double strand break repair.";
RL   J. Biol. Chem. 284:9558-9565(2009).
RN   [19]
RP   HIS-31; VAL-35; LYS-41 AND LEU-45.
RX   PubMed=19759395; DOI=10.1074/jbc.M109.023424;
RA   Yuan J., Chen J.;
RT   "N terminus of CtIP is critical for homologous recombination-mediated
RT   double-strand break repair.";
RL   J. Biol. Chem. 284:31746-31752(2009).
RN   [20]
RX   PubMed=20064462; DOI=10.1016/j.molcel.2009.12.002;
RA   You Z., Shi L.Z., Zhu Q., Wu P., Zhang Y.W., Basilio A., Tonnu N.,
RA   Verma I.M., Berns M.W., Hunter T.;
RT   "CtIP links DNA double-strand break sensing to resection.";
RL   Mol. Cell 36:954-969(2009).
RN   [21]
RC   TISSUE=Leukemic T-cell;
RX   PubMed=19690332; DOI=10.1126/scisignal.2000007;
RA   Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
RA   Rodionov V., Han D.K.;
RT   "Quantitative phosphoproteomic analysis of T cell receptor signaling
RT   reveals system-wide modulation of protein-protein interactions.";
RL   Sci. Signal. 2:RA46-RA46(2009).
RN   [22]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=20068231; DOI=10.1126/scisignal.2000475;
RA   Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
RA   Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
RA   Mann M.;
RT   "Quantitative phosphoproteomics reveals widespread full
RT   phosphorylation site occupancy during mitosis.";
RL   Sci. Signal. 3:RA3-RA3(2010).
RN   [23]
RP   LYS-432; LYS-526 AND LYS-604.
RX   PubMed=20829486; DOI=10.1126/science.1192049;
RA   Kaidi A., Weinert B.T., Choudhary C., Jackson S.P.;
RT   "Human SIRT6 promotes DNA end resection through CtIP deacetylation.";
RL   Science 329:1348-1353(2010).
RN   [24]
RX   PubMed=21799032; DOI=10.1158/0008-5472.CAN-11-0773;
RA   Rebbeck T.R., Mitra N., Domchek S.M., Wan F., Friebel T.M., Tran T.V.,
RA   Singer C.F., Tea M.K., Blum J.L., Tung N., Olopade O.I., Weitzel J.N.,
RA   Lynch H.T., Snyder C.L., Garber J.E., Antoniou A.C., Peock S.,
RA   Evans D.G., Paterson J., Kennedy M.J., Donaldson A., Dorkins H.,
RA   Easton D.F., Rubinstein W.S., Daly M.B., Isaacs C., Nevanlinna H.,
RA   Couch F.J., Andrulis I.L., Freidman E., Laitman Y., Ganz P.A.,
RA   Tomlinson G.E., Neuhausen S.L., Narod S.A., Phelan C.M., Greenberg R.,
RA   Nathanson K.L.;
RT   "Modification of BRCA1-associated breast and ovarian cancer risk by
RT   BRCA1-interacting genes.";
RL   Cancer Res. 71:5792-5805(2011).
RN   [25]
RX   PubMed=21998596; DOI=10.1371/journal.pgen.1002310;
RA   Jackson S.P., Borglum A.D.;
RT   "CtIP mutations cause Seckel and Jawad syndromes.";
RL   PLoS Genet. 7:E1002310-E1002310(2011).
RN   [26]
RX   PubMed=25218447; DOI=10.1038/nsmb.2890;
RA   Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M.,
RA   Vertegaal A.C.;
RT   "Uncovering global SUMOylation signaling networks in a site-specific
RT   manner.";
RL   Nat. Struct. Mol. Biol. 21:927-936(2014).
CC   -!- FUNCTION: Endonuclease that cooperates with the MRE11-RAD50-NBN
CC       (MRN) complex in processing meiotic and mitotic double-strand
CC       breaks (DSBs) by ensuring both resection and intrachromosomal
CC       association of the broken ends. Functions downstream of the MRN
CC       complex and ATM, promotes ATR activation and its recruitment to
CC       DSBs in the S/G2 phase facilitating the generation of ssDNA.
CC       Component of the BRCA1-RBBP8 complex that regulates CHEK1
CC       activation and controls cell cycle G2/M checkpoints on DNA damage.
CC       Promotes microhomology-mediated alternative end joining (A-NHEJ)
CC       during class-switch recombination and plays an essential role in
CC       chromosomal translocations. {ECO:0000269|PubMed:10764811,
CC       ECO:0000269|PubMed:10910365, ECO:0000269|PubMed:15485915,
CC       ECO:0000269|PubMed:16581787, ECO:0000269|PubMed:16818604,
CC       ECO:0000269|PubMed:17965729, ECO:0000269|PubMed:19202191,
CC       ECO:0000269|PubMed:19759395, ECO:0000269|PubMed:20064462,
CC       ECO:0000269|PubMed:20829486}.
CC   -!- SUBUNIT: Homodimer; dimerizes via the coiled coil domain.
CC       Interacts (via the PXDLS motif) with CTBP1; the interaction is
CC       disrupted via binding of the adenovirus E1A to CTBP1. Component of
CC       the BRCA1-RBBBP8 complex. Interacts (the Ser-327 phosphorylated
CC       form) with BRCA1 (via the C-terminal BRCA1 domains): the
CC       interaction occurs in the G2 phase, ubiquitinates RBBP8 and
CC       involves RBBP8 in BRCA1-dependent G2/M checkpoint control on DNA
CC       damage. Interacts with RB1. Interacts with the MRN complex.
CC       Interacts directly with MRE11A; the interaction is required for
CC       efficient homologous recombination (HR) and regulation of the MRN
CC       complex. Interacts directly with RAD50. Interacts directly with
CC       NBN. Interacts with SIRT6; the interaction deacetylates RBBP8 upon
CC       DNA damage. Interacts with LM04 (via the LIM zinc-binding 1
CC       domain). {ECO:0000269|PubMed:10764811,
CC       ECO:0000269|PubMed:11751867, ECO:0000269|PubMed:14654780,
CC       ECO:0000269|PubMed:15084581, ECO:0000269|PubMed:15485915,
CC       ECO:0000269|PubMed:16818604, ECO:0000269|PubMed:17965729,
CC       ECO:0000269|PubMed:19759395, ECO:0000269|PubMed:20829486,
CC       ECO:0000269|PubMed:9535825, ECO:0000269|PubMed:9721205}.
CC       P38398:BRCA1; NbExp=9; IntAct=EBI-745715, EBI-349905;
CC       Q9UQ84:EXO1; NbExp=3; IntAct=EBI-745715, EBI-944667;
CC       P25800:LMO1; NbExp=3; IntAct=EBI-10203615, EBI-8639312;
CC       P61968:LMO4; NbExp=3; IntAct=EBI-10203615, EBI-2798728;
CC       Q13526:PIN1; NbExp=3; IntAct=EBI-10203615, EBI-714158;
CC   -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10764811,
CC       ECO:0000269|PubMed:17965729}. Note=Associates with sites of DNA
CC       damage in S/G2 phase. Ubiquitinated RBBP8 binds to chromatin
CC       following DNA damage.
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=Q99708-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q99708-2; Sequence=VSP_043220;
CC       Name=3;
CC         IsoId=Q99708-3; Sequence=VSP_045247, VSP_045248;
CC         Note=No experimental confirmation available. Ref.4 (BX648221)
CC         sequence is in conflict in position: 862:S->G. {ECO:0000305};
CC   -!- INDUCTION: Levels increase dramatically as dividing cells traverse
CC       the G1/S boubdary. Down-regulated in tamoxifen-resistant breast
CC       cancer cells.
CC   -!- DOMAIN: The PXDLS motif binds to a cleft in CtBP proteins.
CC   -!- DOMAIN: The damage-recruitment motif is required for DNA binding
CC       and translocation to sites of DNA damage.
CC   -!- PTM: Acetylated. Deacetylation by SIRT6 upon DNA damage promotes
CC       DNA end resection. {ECO:0000269|PubMed:20829486}.
CC   -!- PTM: Hyperphosphorylation upon ionizing radiation results in
CC       dissociation from BRCA1. Phosphorylation at Thr-847 by CDK1 is
CC       essential for the recruitment to DNA and the DNA repair function.
CC       Phosphorylated on Ser-327 as cells enter G2 phase. This
CC       phosphorylation is required for binding BRCA1 and for the G2/M DNA
CC       damage transition checkpoint control.
CC       {ECO:0000269|PubMed:10910365, ECO:0000269|PubMed:15485915,
CC       ECO:0000269|PubMed:17965729, ECO:0000269|PubMed:19202191}.
CC   -!- PTM: Ubiquitinated. Ubiquitination at multiple sites by BRCA1 (via
CC       its N-terminal RING domain) does not lead to its proteosomal
CC       degradation but instead the ubiquitinated RBBP8 binds to chromatin
CC       following DNA damage and may play a role in G2/M checkpoint
CC       control. {ECO:0000269|PubMed:14654780,
CC       ECO:0000269|PubMed:16818604}.
CC   -!- DISEASE: Seckel syndrome 2 (SCKL2) [MIM:606744]: A rare autosomal
CC       recessive disorder characterized by proportionate dwarfism of
CC       prenatal onset associated with low birth weight, growth
CC       retardation, severe microcephaly with a bird-headed like
CC       appearance, and mental retardation. {ECO:0000269|PubMed:21998596}.
CC       Note=The disease is caused by mutations affecting the gene
CC       represented in this entry.
CC   -!- DISEASE: Jawad syndrome (JWDS) [MIM:251255]: A syndrome
CC       characterized by congenital microcephaly, moderately severe mental
CC       retardation, and symmetrical digital anomalies. Digital
CC       malformations of variable degree include hallux valgus, syndactyly
CC       of toes 4 and 5, short fifth fingers, single flexion crease of
CC       fifth fingers, polydactyly and synpolydactyly.
CC       {ECO:0000269|PubMed:21998596}. Note=The disease is caused by
CC       mutations affecting the gene represented in this entry.
CC   -!- DISEASE: Note=Genetic variability in RBBP8 is noted as a factor in
CC       BRCA1-associated breast cancer risk. Exhibits sensitivity to
CC       tamoxifen in certain breast cancer cell lines.
CC   -!- SIMILARITY: Belongs to the COM1/SAE2/CtIP family. {ECO:0000305}.
CC   -!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
CC       and Haematology;
CC       URL="";
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF043431; AAC34368.1; -; mRNA.
DR   EMBL; U72066; AAC14371.1; -; mRNA.
DR   EMBL; AK292481; BAF85170.1; -; mRNA.
DR   EMBL; AC091147; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC106033; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471088; EAX01144.1; -; Genomic_DNA.
DR   EMBL; BC030590; AAH30590.1; -; mRNA.
DR   CCDS; CCDS11874.1; -. [Q99708-3]
DR   CCDS; CCDS11875.1; -. [Q99708-1]
DR   RefSeq; NP_002885.1; NM_002894.2. [Q99708-1]
DR   RefSeq; NP_976036.1; NM_203291.1. [Q99708-1]
DR   RefSeq; NP_976037.1; NM_203292.1. [Q99708-3]
DR   RefSeq; XP_006722582.1; XM_006722519.1. [Q99708-1]
DR   RefSeq; XP_006722583.1; XM_006722520.1. [Q99708-1]
DR   RefSeq; XP_006722584.1; XM_006722521.1. [Q99708-1]
DR   RefSeq; XP_011524434.1; XM_011526132.1. [Q99708-1]
DR   UniGene; Hs.546282; -.
DR   PDB; 2L4Z; NMR; -; A=641-685.
DR   PDB; 4D2H; X-ray; 1.90 A; A/B/C/D/E/F/G/H=18-52.
DR   PDBsum; 2L4Z; -.
DR   PDBsum; 4D2H; -.
DR   ProteinModelPortal; Q99708; -.
DR   SMR; Q99708; 18-52, 641-677.
DR   BioGrid; 111867; 43.
DR   DIP; DIP-24244N; -.
DR   IntAct; Q99708; 27.
DR   MINT; MINT-102295; -.
DR   STRING; 9606.ENSP00000323050; -.
DR   PhosphoSite; Q99708; -.
DR   BioMuta; RBBP8; -.
DR   DMDM; 116242745; -.
DR   MaxQB; Q99708; -.
DR   PaxDb; Q99708; -.
DR   PRIDE; Q99708; -.
DR   DNASU; 5932; -.
DR   Ensembl; ENST00000327155; ENSP00000323050; ENSG00000101773. [Q99708-1]
DR   Ensembl; ENST00000399722; ENSP00000382628; ENSG00000101773. [Q99708-1]
DR   Ensembl; ENST00000399725; ENSP00000382630; ENSG00000101773. [Q99708-3]
DR   GeneID; 5932; -.
DR   KEGG; hsa:5932; -.
DR   UCSC; uc002ktw.3; human. [Q99708-1]
DR   UCSC; uc002ktz.3; human.
DR   CTD; 5932; -.
DR   GeneCards; RBBP8; -.
DR   GeneReviews; RBBP8; -.
DR   HGNC; HGNC:9891; RBBP8.
DR   HPA; HPA039890; -.
DR   HPA; HPA052946; -.
DR   MIM; 251255; phenotype.
DR   MIM; 604124; gene.
DR   MIM; 606744; phenotype.
DR   neXtProt; NX_Q99708; -.
DR   Orphanet; 313795; Jawad syndrome.
DR   Orphanet; 808; Seckel syndrome.
DR   PharmGKB; PA34255; -.
DR   eggNOG; ENOG410IJ39; Eukaryota.
DR   GeneTree; ENSGT00530000063835; -.
DR   HOGENOM; HOG000293331; -.
DR   HOVERGEN; HBG057046; -.
DR   InParanoid; Q99708; -.
DR   OrthoDB; EOG771274; -.
DR   PhylomeDB; Q99708; -.
DR   TreeFam; TF106469; -.
DR   Reactome; R-HSA-912446; Meiotic recombination.
DR   ChiTaRS; RBBP8; human.
DR   EvolutionaryTrace; Q99708; -.
DR   GeneWiki; RBBP8; -.
DR   GenomeRNAi; 5932; -.
DR   NextBio; 23118; -.
DR   PRO; PR:Q99708; -.
DR   Proteomes; UP000005640; Chromosome 18.
DR   Bgee; Q99708; -.
DR   CleanEx; HS_RBBP8; -.
DR   ExpressionAtlas; Q99708; baseline and differential.
DR   Genevisible; Q99708; HS.
DR   GO; GO:0005730; C:nucleolus; IDA:HPA.
DR   GO; GO:0005654; C:nucleoplasm; IDA:HPA.
DR   GO; GO:0005634; C:nucleus; TAS:ProtInc.
DR   GO; GO:0017053; C:transcriptional repressor complex; IDA:BHF-UCL.
DR   GO; GO:0003684; F:damaged DNA binding; IDA:UniProtKB.
DR   GO; GO:0001103; F:RNA polymerase II repressing transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0001106; F:RNA polymerase II transcription corepressor activity; IDA:BHF-UCL.
DR   GO; GO:0000014; F:single-stranded DNA endodeoxyribonuclease activity; IMP:UniProtKB.
DR   GO; GO:0001835; P:blastocyst hatching; IEA:Ensembl.
DR   GO; GO:0000075; P:cell cycle checkpoint; TAS:ProtInc.
DR   GO; GO:0051301; P:cell division; IEA:UniProtKB-KW.
DR   GO; GO:0010792; P:DNA double-strand break processing involved in repair via single-strand annealing; IMP:UniProtKB.
DR   GO; GO:0006281; P:DNA repair; TAS:ProtInc.
DR   GO; GO:0000724; P:double-strand break repair via homologous recombination; IDA:UniProtKB.
DR   GO; GO:0000082; P:G1/S transition of mitotic cell cycle; IEA:Ensembl.
DR   GO; GO:0031572; P:G2 DNA damage checkpoint; IDA:UniProtKB.
DR   GO; GO:0051321; P:meiotic cell cycle; IEA:UniProtKB-KW.
DR   GO; GO:0007067; P:mitotic nuclear division; IEA:UniProtKB-KW.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:GOC.
DR   GO; GO:0006289; P:nucleotide-excision repair; IMP:CACAO.
DR   GO; GO:0006357; P:regulation of transcription from RNA polymerase II promoter; TAS:ProtInc.
DR   GO; GO:0032355; P:response to estradiol; IEA:Ensembl.
DR   InterPro; IPR013882; Com1/Ctip_fam.
DR   InterPro; IPR019518; CtIP_N.
DR   Pfam; PF10482; CtIP_N; 1.
DR   Pfam; PF08573; SAE2; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Acetylation; Alternative splicing; Cell cycle;
KW   Cell division; Coiled coil; Complete proteome; DNA damage; DNA repair;
KW   DNA-binding; Dwarfism; Endonuclease; Hydrolase; Isopeptide bond;
KW   Meiosis; Mental retardation; Mitosis; Nuclease; Nucleus;
KW   Phosphoprotein; Polymorphism; Reference proteome; Ubl conjugation.
FT   CHAIN         1    897       DNA endonuclease RBBP8.
FT                                /FTId=PRO_0000097179.
FT   REGION       22     45       Essential for binding to the MRN complex
FT                                and for RPA focus formation on DNA
FT                                damage.
FT   REGION      509    557       Damage-recruitment motif.
FT   COILED       28    157       {ECO:0000255}.
FT   MOTIF       490    494       PXDLS motif.
FT   COMPBIAS    750    753       Poly-Glu.
FT   MOD_RES     233    233       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:Q80YR6}.
FT   MOD_RES     326    326       Phosphoserine.
FT                                {ECO:0000269|PubMed:17965729}.
FT   MOD_RES     327    327       Phosphoserine.
FT                                {ECO:0000269|PubMed:15485915}.
FT   MOD_RES     349    349       Phosphoserine.
FT                                {ECO:0000269|PubMed:17965729}.
FT   MOD_RES     432    432       N6-acetyllysine.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MOD_RES     526    526       N6-acetyllysine.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MOD_RES     604    604       N6-acetyllysine.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MOD_RES     664    664       Phosphoserine; by ATM.
FT                                {ECO:0000269|PubMed:10910365}.
FT   MOD_RES     679    679       Phosphoserine.
FT                                {ECO:0000269|PubMed:17965729}.
FT   MOD_RES     723    723       Phosphoserine.
FT                                {ECO:0000244|PubMed:20068231}.
FT   MOD_RES     745    745       Phosphoserine; by ATM.
FT                                {ECO:0000269|PubMed:10910365}.
FT   MOD_RES     847    847       Phosphothreonine; by CDK1.
FT                                {ECO:0000269|PubMed:19202191}.
FT   CROSSLNK    869    869       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   VAR_SEQ     714    714       S -> SMLFYI (in isoform 2).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_043220.
FT                                HRR (in isoform 3).
FT                                {ECO:0000303|PubMed:17974005}.
FT                                /FTId=VSP_045247.
FT   VAR_SEQ     868    897       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:17974005}.
FT                                /FTId=VSP_045248.
FT   VARIANT     357    357       K -> N (in dbSNP:rs34678569).
FT                                /FTId=VAR_051308.
FT   VARIANT     387    387       H -> Y (in dbSNP:rs1804732).
FT                                /FTId=VAR_028308.
FT   MUTAGEN      31     31       H->A: No effect on RPA focus formation on
FT                                DNA damage.
FT                                {ECO:0000269|PubMed:19759395}.
FT   MUTAGEN      35     35       V->A: No effect on RPA focus formation on
FT                                DNA damage.
FT                                {ECO:0000269|PubMed:19759395}.
FT   MUTAGEN      41     41       K->A: No effect on RPA focus formation on
FT                                DNA damage.
FT                                {ECO:0000269|PubMed:19759395}.
FT   MUTAGEN      45     45       L->A: No effect on RPA focus formation on
FT                                DNA damage.
FT                                {ECO:0000269|PubMed:19759395}.
FT   MUTAGEN     327    327       S->A: Abolishes BRCA1 interaction and
FT                                ubiquitination. No activation of CHEK1
FT                                after DNA damage.
FT                                {ECO:0000269|PubMed:15485915,
FT                                ECO:0000269|PubMed:16818604}.
FT   MUTAGEN     432    432       K->R: Greatly reduced acetylation.
FT                                Alleviates resection defects caused by
FT                                depletion of SIRT6; when associated with
FT                                R-526 and R-604.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MUTAGEN     513    513       K->A: Abolishes damage recruitment
FT                                capability.
FT                                {ECO:0000269|PubMed:20064462}.
FT   MUTAGEN     515    515       K->A: Abolishes damage recruitment
FT                                capability.
FT                                {ECO:0000269|PubMed:20064462}.
FT   MUTAGEN     526    526       K->R: Greatly reduced acetylation.
FT                                Alleviates resection defects caused by
FT                                depletion of SIRT6; when associated with
FT                                R-432 and R-604.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MUTAGEN     604    604       K->R: Greatly reduced acetylation.
FT                                Alleviates resection defects caused by
FT                                depletion of SIRT6; when associated with
FT                                R-432 and R-526.
FT                                {ECO:0000269|PubMed:20829486}.
FT   MUTAGEN     664    664       S->A: Abrogates dissociation of BRCA1.
FT                                {ECO:0000269|PubMed:10910365}.
FT   MUTAGEN     745    745       S->A: Abrogates dissociation of BRCA1.
FT                                {ECO:0000269|PubMed:10910365}.
FT   MUTAGEN     847    847       T->A: Impairs DNA resection.
FT                                {ECO:0000269|PubMed:19202191}.
FT   MUTAGEN     847    847       T->E: Mimics constitutive
FT                                phosphorylation.
FT                                {ECO:0000269|PubMed:19202191}.
FT   CONFLICT      4      4       S -> L (in Ref. 1; AAC14371).
FT                                {ECO:0000305}.
FT   CONFLICT     74     74       H -> Q (in Ref. 4; BX648221).
FT                                {ECO:0000305}.
FT   CONFLICT     92     92       C -> Y (in Ref. 3; BAF85170).
FT                                {ECO:0000305}.
FT   CONFLICT    123    123       E -> G (in Ref. 3; BAF85170).
FT                                {ECO:0000305}.
FT   CONFLICT    341    341       D -> G (in Ref. 4; BX648221).
FT                                {ECO:0000305}.
FT   CONFLICT    515    515       K -> R (in Ref. 4; BX648221).
FT                                {ECO:0000305}.
FT   CONFLICT    521    521       L -> P (in Ref. 3; BAF85170).
FT                                {ECO:0000305}.
FT   CONFLICT    642    642       L -> P (in Ref. 4; BX648221).
FT                                {ECO:0000305}.
FT   HELIX        18     50       {ECO:0000244|PDB:4D2H}.
FT   STRAND      648    650       {ECO:0000244|PDB:2L4Z}.
FT   HELIX       651    653       {ECO:0000244|PDB:2L4Z}.
FT   TURN        662    666       {ECO:0000244|PDB:2L4Z}.
FT   STRAND      677    679       {ECO:0000244|PDB:2L4Z}.
SQ   SEQUENCE   897 AA;  101942 MW;  E028DE56DE55C0F2 CRC64;
ID   E1A_ADE02               Reviewed;         289 AA.
AC   P03254; P24934; Q67788;
DT   21-JUL-1986, integrated into UniProtKB/Swiss-Prot.
DT   21-JUL-1986, sequence version 1.
DT   11-NOV-2015, entry version 96.
DE   RecName: Full=Early E1A protein {ECO:0000305};
DE   AltName: Full=Early E1A 32 kDa protein;
OS   Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2).
OC   Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
OX   NCBI_TaxID=10515;
OH   NCBI_TaxID=9606; Homo sapiens (Human).
RN   [1]
RX   PubMed=551290; DOI=10.1038/281694a0;
RA   Perricaudet M., Akusjaervi G., Virtanen A., Pettersson U.;
RT   "Structure of two spliced mRNAs from the transforming region of human
RT   subgroup C adenoviruses.";
RL   Nature 281:694-696(1979).
RN   [2]
RX   PubMed=7142161;
RA   Gingeras T.R., Sciaky D., Gelinas R.E., Bing-Dong J., Yen C.E.,
RA   Kelly M.M., Bullock P.A., Parsons B.L., O'Neill K.E., Roberts R.J.;
RT   "Nucleotide sequences from the adenovirus-2 genome.";
RL   J. Biol. Chem. 257:13475-13491(1982).
RN   [3]
RP   SER-185.
RX   PubMed=8417352;
RA   Chatton B., Bocco J.L., Gaire M., Hauss C., Reimund B., Goetz J.,
RA   Kedinger C.;
RT   "Transcriptional activation by the adenovirus larger E1a product is
RT   mediated by members of the cellular transcription factor ATF family
RT   which can directly associate with E1a.";
RL   Mol. Cell. Biol. 13:561-570(1993).
CC   -!- FUNCTION: Plays a role in viral genome replication by driving
CC       entry of quiescent cells into the cell cycle. Stimulation of
CC       progression from G1 to S phase allows the virus to efficiently use
CC       the cellular DNA replicating machinery to achieve viral genome
CC       replication. E1A protein has both transforming and trans-
CC       activating activities. Induces the disassembly of the E2F1
CC       transcription factor from RB1 by direct competition for the same
CC       binding site on RB1, with subsequent transcriptional activation of
CC       E2F1-regulated S-phase genes and of the E2 region of the
CC       adenoviral genome. Release of E2F1 leads to the ARF-mediated
CC       inhibition of MDM2 and causes TP53/p53 to accumulate because it is
CC       not targeted for degradation by MDM2-mediated ubiquitination
CC       anymore. This increase in TP53, in turn, would arrest the cell
CC       proliferation and direct its death but this effect is counteracted
CC       by the viral protein E1B-55K. Inactivation of the ability of RB1
CC       to arrest the cell cycle is critical for cellular transformation,
CC       uncontrolled cellular growth and proliferation induced by viral
CC       infection. Interaction with RBX1 and CUL1 inhibits ubiquitination
CC       of the proteins targeted by SCF(FBXW7) ubiquitin ligase complex,
CC       and may be linked to unregulated host cell proliferation. The
CC       tumorigenesis-restraining activity of E1A may be related to the
CC       disruption of the host CtBP-CtIP complex through the CtBP binding
CC       motif. Interacts with host TBP protein; this interaction probably
CC       disrupts the TBP-TATA complex. {ECO:0000250|UniProtKB:P03255}.
CC   -!- SUBUNIT: Interacts with host UBE2I; this interaction interferes
CC       with polySUMOylation. Interacts with host RB1; this interaction
CC       induces the aberrant dissociation of RB1-E2F1 complex thereby
CC       disrupting the activity of RB1 and activating E2F1-regulated
CC       genes. Interacts with host ATF7; the interaction enhances ATF7-
CC       mediated viral transactivation activity which requires the zinc
CC       binding domains of both proteins. Isoform early E1A 32 kDa protein
CC       and isoform early E1A 26 kDa protein interact (via N-terminus)
CC       with CUL1 and E3 ubiquitin ligase RBX1; these interactions inhibit
CC       RBX1-CUL1-dependent elongation reaction of ubiquitin chains and
CC       attenuate ubiquitination of SCF(FBXW7) target proteins. Interacts
CC       (via PXLXP motif) with host ZMYND11/BS69 (via MYND-type zinc
CC       finger); this interaction inhibits E1A mediated transactivation.
CC       Interacts with host EP300; this interaction stimulates the
CC       acetylation of RB1 by recruiting EP300 and RB1 into a multimeric-
CC       protein complex. Interacts with host CTBP1 and CTBP2; this
CC       interaction seems to potentiate viral replication. Interacts with
CC       host DCAF7. Interacts with host DYRK1A. Interacts with host KPNA4;
CC       this interaction allows E1A import into the host nucleus.
CC       Interacts with host EP400; this interaction stabilizes MYC.
CC       {ECO:0000250|UniProtKB:P03255}.
CC   -!- SUBCELLULAR LOCATION: Host nucleus {ECO:0000250|UniProtKB:P03255}.
CC       Event=Alternative splicing; Named isoforms=3;
CC         Comment=Isoforms are derived from the E1 region of the genome.;
CC       Name=early E1A 32 kDa protein; Synonyms=289R, L-E1A;
CC         IsoId=P03254-1; Sequence=Displayed;
CC       Name=early E1A 26 kDa protein; Synonyms=243R, S-E1A;
CC         IsoId=P03254-2; Sequence=VSP_000197;
CC       Name=early E1A 6 kDa protein;
CC         IsoId=P03254-3; Sequence=VSP_028916, VSP_028917;
CC   -!- SIMILARITY: Belongs to the adenoviridae E1A protein family.
CC       {ECO:0000305}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; J01917; AAA92197.1; -; Genomic_DNA.
DR   EMBL; J01917; AAA92198.1; -; Genomic_DNA.
DR   EMBL; J01917; AAA92199.1; -; Genomic_DNA.
DR   PIR; A03824; Q2AD2.
DR   RefSeq; AP_000161.1; AC_000007.1.
DR   DIP; DIP-570N; -.
DR   IntAct; P03254; 1.
DR   MINT; MINT-198575; -.
DR   Proteomes; UP000008167; Genome.
DR   GO; GO:0042025; C:host cell nucleus; IEA:UniProtKB-SubCell.
DR   GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
DR   GO; GO:0039695; P:DNA-templated viral transcription; IDA:UniProtKB.
DR   GO; GO:0039645; P:modulation by virus of host G1/S transition checkpoint; IEA:UniProtKB-KW.
DR   GO; GO:0039649; P:modulation by virus of host ubiquitin-protein ligase activity; IEA:UniProtKB-KW.
DR   GO; GO:0006355; P:regulation of transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0039657; P:suppression by virus of host gene expression; IEA:UniProtKB-KW.
DR   GO; GO:0039563; P:suppression by virus of host STAT1 activity; IEA:UniProtKB-KW.
DR   GO; GO:0039502; P:suppression by virus of host type I interferon-mediated signaling pathway; IEA:UniProtKB-KW.
DR   InterPro; IPR014410; Aden_E1A.
DR   Pfam; PF02703; Adeno_E1A; 1.
PE   1: Evidence at protein level;
KW   Activator; Alternative splicing; Complete proteome; Early protein;
KW   Eukaryotic host gene expression shutoff by virus;
KW   Eukaryotic host transcription shutoff by virus;
KW   G1/S host cell cycle checkpoint dysregulation by virus;
KW   Host gene expression shutoff by virus; Host nucleus;
KW   Host-virus interaction;
KW   Inhibition of eukaryotic host transcription initiation by virus;
KW   Inhibition of host innate immune response by virus;
KW   Inhibition of host interferon signaling pathway by virus;
KW   Inhibition of host STAT1 by virus; Metal-binding;
KW   Modulation of host cell cycle by virus;
KW   Modulation of host E3 ubiquitin ligases by virus;
KW   Modulation of host ubiquitin pathway by virus; Oncogene;
KW   Phosphoprotein; Reference proteome; Transcription;
KW   Transcription regulation; Viral immunoevasion; Zinc; Zinc-finger.
FT   CHAIN         1    289       Early E1A protein.
FT                                /FTId=PRO_0000221692.
FT   ZN_FING     154    174       {ECO:0000250|UniProtKB:P03255}.
FT   REGION       41     49       Interaction with RB1 in competition with
FT                                E2F1. {ECO:0000250}.
FT   REGION       76    140       Interaction with UBE2I. {ECO:0000250}.
FT   MOTIF       113    117       PXLXP motif, interaction with host
FT                                ZMYND11. {ECO:0000250}.
FT   MOTIF       122    126       LXCXE motif, interaction with host RB1.
FT                                {ECO:0000255}.
FT   MOTIF       258    289       Bipartite nuclear localization signal.
FT                                {ECO:0000250|UniProtKB:P03255,
FT                                ECO:0000255}.
FT   MOTIF       279    283       PXDLS motif, CTBP-binding.
FT                                {ECO:0000250|UniProtKB:P03255}.
FT   MOD_RES      89     89       Phosphoserine; by host. {ECO:0000250}.
FT   MOD_RES     219    219       Phosphoserine; by host. {ECO:0000250}.
FT   MOD_RES     231    231       Phosphoserine; by host. {ECO:0000250}.
FT                                NRSLQDLPGVLNWCLLS (in isoform early E1A 6
FT                                kDa protein). {ECO:0000305}.
FT                                /FTId=VSP_028916.
FT   VAR_SEQ      56    289       Missing (in isoform early E1A 6 kDa
FT                                protein). {ECO:0000305}.
FT                                /FTId=VSP_028917.
FT   VAR_SEQ     140    185       Missing (in isoform early E1A 26 kDa
FT                                protein). {ECO:0000305}.
FT                                /FTId=VSP_000197.
FT   MUTAGEN     157    157       C->S: Abolishes ATF7-mediated
FT                                transcriptional activation.
FT                                {ECO:0000269|PubMed:8417352}.
FT   MUTAGEN     178    178       T->P: No effect on ATF7-mediated
FT                                transcriptional activation.
FT                                {ECO:0000269|PubMed:8417352}.
FT   MUTAGEN     185    185       S->R: Abolishes ATF7-mediated
FT                                transcriptional activation.
FT                                {ECO:0000269|PubMed:8417352}.
FT   CONFLICT     68     68       D -> E (in Ref. 2; AAA92197/AAA92199).
FT                                {ECO:0000305}.
FT   CONFLICT     81     81       L -> F (in Ref. 2; AAA92197/AAA92199).
FT                                {ECO:0000305}.
SQ   SEQUENCE   289 AA;  31851 MW;  4264747DAD74FFC5 CRC64;
ID   ELK3_HUMAN              Reviewed;         407 AA.
AC   P41970; B2R6S6; Q6FG57; Q6GU29; Q9UD17;
DT   01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
DT   17-OCT-2006, sequence version 2.
DT   11-NOV-2015, entry version 142.
DE   RecName: Full=ETS domain-containing protein Elk-3;
DE   AltName: Full=ETS-related protein ERP;
DE   AltName: Full=ETS-related protein NET;
DE   AltName: Full=Serum response factor accessory protein 2;
DE            Short=SAP-2;
DE            Short=SRF accessory protein 2;
GN   Name=ELK3; Synonyms=NET, SAP2;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RX   PubMed=7958835; DOI=10.1101/gad.8.13.1502;
RA   Giovane A., Pintzas A., Maira S.-M., Sobieszczuk P., Wasylyk B.;
RT   "Net, a new ets transcription factor that is activated by Ras.";
RL   Genes Dev. 8:1502-1513(1994).
RN   [2]
RC   TISSUE=Placenta;
RX   PubMed=7540136;
RA   Price M.A., Rogers A.E., Treisman R.;
RT   "Comparative analysis of the ternary complex factors Elk-1, SAP-1a and
RT   SAP-2 (ERP/NET).";
RL   EMBO J. 14:2589-2601(1995).
RN   [3]
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201).";
RL   Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [5]
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=18691976; DOI=10.1016/j.molcel.2008.07.007;
RA   Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,
RA   Greff Z., Keri G., Stemmann O., Mann M.;
RT   "Kinase-selective enrichment enables quantitative phosphoproteomics of
RT   the kinome across the cell cycle.";
RL   Mol. Cell 31:438-448(2008).
CC   -!- FUNCTION: May be a negative regulator of transcription, but can
CC       activate transcription when coexpressed with Ras, Src or Mos.
CC       Forms a ternary complex with the serum response factor and the ETS
CC       and SRF motifs of the Fos serum response element.
CC   -!- SUBUNIT: Interacts with CTBP1.
CC       P16333:NCK1; NbExp=3; IntAct=EBI-1758534, EBI-389883;
CC       P27986:PIK3R1; NbExp=2; IntAct=EBI-1758534, EBI-79464;
CC   -!- SIMILARITY: Belongs to the ETS family. {ECO:0000305}.
CC   -!- SIMILARITY: Contains 1 ETS DNA-binding domain.
CC       {ECO:0000255|PROSITE-ProRule:PRU00237}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; Z36715; CAA85309.1; -; mRNA.
DR   EMBL; CR542251; CAG47047.1; -; mRNA.
DR   EMBL; AK312694; BAG35573.1; -; mRNA.
DR   EMBL; CH471054; EAW97561.1; -; Genomic_DNA.
DR   EMBL; BC017371; AAH17371.1; -; mRNA.
DR   CCDS; CCDS9060.1; -.
DR   PIR; I38062; I38062.
DR   RefSeq; NP_005221.2; NM_005230.3.
DR   RefSeq; XP_006719338.1; XM_006719275.2.
DR   UniGene; Hs.46523; -.
DR   UniGene; Hs.718709; -.
DR   ProteinModelPortal; P41970; -.
DR   SMR; P41970; 2-151.
DR   BioGrid; 108319; 3.
DR   IntAct; P41970; 4.
DR   MINT; MINT-7242082; -.
DR   STRING; 9606.ENSP00000228741; -.
DR   PhosphoSite; P41970; -.
DR   BioMuta; ELK3; -.
DR   DMDM; 116241349; -.
DR   MaxQB; P41970; -.
DR   PaxDb; P41970; -.
DR   PRIDE; P41970; -.
DR   DNASU; 2004; -.
DR   Ensembl; ENST00000228741; ENSP00000228741; ENSG00000111145.
DR   GeneID; 2004; -.
DR   UCSC; uc001teo.1; human.
DR   CTD; 2004; -.
DR   GeneCards; ELK3; -.
DR   HGNC; HGNC:3325; ELK3.
DR   HPA; HPA001600; -.
DR   MIM; 600247; gene.
DR   neXtProt; NX_P41970; -.
DR   PharmGKB; PA27752; -.
DR   eggNOG; KOG3806; Eukaryota.
DR   GeneTree; ENSGT00760000118996; -.
DR   HOGENOM; HOG000237332; -.
DR   HOVERGEN; HBG004344; -.
DR   InParanoid; P41970; -.
DR   OrthoDB; EOG7NPFTD; -.
DR   PhylomeDB; P41970; -.
DR   TreeFam; TF317732; -.
DR   SignaLink; P41970; -.
DR   GeneWiki; ELK3; -.
DR   GenomeRNAi; 2004; -.
DR   NextBio; 8109; -.
DR   PRO; PR:P41970; -.
DR   Proteomes; UP000005640; Chromosome 12.
DR   Bgee; P41970; -.
DR   CleanEx; HS_ELK3; -.
DR   ExpressionAtlas; P41970; baseline and differential.
DR   Genevisible; P41970; HS.
DR   GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
DR   GO; GO:0005739; C:mitochondrion; IDA:HPA.
DR   GO; GO:0005654; C:nucleoplasm; IDA:HPA.
DR   GO; GO:0005634; C:nucleus; IC:HGNC.
DR   GO; GO:0032422; F:purine-rich negative regulatory element binding; IDA:HGNC.
DR   GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IDA:NTNU_SB.
DR   GO; GO:0003714; F:transcription corepressor activity; IDA:HGNC.
DR   GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; NAS:ProtInc.
DR   GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:NTNU_SB.
DR   GO; GO:0001525; P:angiogenesis; IEA:Ensembl.
DR   GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:HGNC.
DR   GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:NTNU_SB.
DR   GO; GO:0007165; P:signal transduction; TAS:ProtInc.
DR   GO; GO:0006366; P:transcription from RNA polymerase II promoter; IDA:GOC.
DR   GO; GO:0042060; P:wound healing; IEA:Ensembl.
DR   Gene3D;; -; 1.
DR   InterPro; IPR000418; Ets_dom.
DR   InterPro; IPR011991; WHTH_DNA-bd_dom.
DR   Pfam; PF00178; Ets; 1.
DR   SMART; SM00413; ETS; 1.
PE   1: Evidence at protein level;
KW   Activator; Complete proteome; DNA-binding; Nucleus; Phosphoprotein;
KW   Polymorphism; Reference proteome; Repressor; Transcription;
KW   Transcription regulation.
FT   CHAIN         1    407       ETS domain-containing protein Elk-3.
FT                                /FTId=PRO_0000204097.
FT   DNA_BIND      5     85       ETS. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00237}.
FT   MOTIF       273    277       CTBP-binding motif.
FT   COMPBIAS    207    212       Poly-Ala.
FT   MOD_RES     115    115       Phosphoserine.
FT                                {ECO:0000244|PubMed:18691976}.
FT   VARIANT     169    169       P -> L (in dbSNP:rs35332676).
FT                                /FTId=VAR_048946.
FT   CONFLICT    114    114       A -> V (in Ref. 1; CAA85309).
FT                                {ECO:0000305}.
FT   CONFLICT    117    117       E -> G (in Ref. 3; CAG47047).
FT                                {ECO:0000305}.
FT   CONFLICT    128    128       A -> V (in Ref. 1; CAA85309).
FT                                {ECO:0000305}.
FT   CONFLICT    152    152       Q -> E (in Ref. 1; CAA85309).
FT                                {ECO:0000305}.
FT   CONFLICT    163    163       T -> R (in Ref. 1; CAA85309).
FT                                {ECO:0000305}.
FT   CONFLICT    249    249       N -> K (in Ref. 1; CAA85309).
FT                                {ECO:0000305}.
SQ   SEQUENCE   407 AA;  44240 MW;  DD4515270ECED1E3 CRC64;
ID   EVI1_HUMAN              Reviewed;        1051 AA.
AC   Q03112; A1L4F3; A8KA00; B7Z8W7; B7ZLQ3; B7ZLQ4; C9JAK0; D3DNP7;
AC   Q16122; Q5HYI1; Q6MZS6; Q8NEI5; Q99917;
DT   01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
DT   17-APR-2007, sequence version 2.
DT   11-NOV-2015, entry version 153.
DE   RecName: Full=MDS1 and EVI1 complex locus protein EVI1;
DE   AltName: Full=Ecotropic virus integration site 1 protein homolog;
DE            Short=EVI-1;
GN   Name=MECOM; Synonyms=EVI1;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RX   PubMed=2115646;
RA   Morishita K., Parganas E., Douglass E.C., Ihle J.N.;
RT   "Unique expression of the human Evi-1 gene in an endometrial carcinoma
RT   cell line: sequence of cDNAs and structure of alternatively spliced
RT   transcripts.";
RL   Oncogene 5:963-971(1990).
RN   [2]
RX   PubMed=8313895;
RA   Mitani K., Ogawa S., Tanaka T., Miyoshi H., Kurokawa M., Mano H.,
RA   Yazaki Y., Ohki M., Hirai H.;
RT   "Generation of the AML1-EVI-1 fusion gene in the t(3;21)(q26;q22)
RT   causes blastic crisis in chronic myelocytic leukemia.";
RL   EMBO J. 13:504-510(1994).
RN   [3]
RC   TISSUE=Trachea;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [4]
RC   TISSUE=Adipose tissue, and Fetal kidney;
RX   PubMed=17974005; DOI=10.1186/1471-2164-8-399;
RA   Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
RA   Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
RA   Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
RA   Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
RT   "The full-ORF clone resource of the German cDNA consortium.";
RL   BMC Genomics 8:399-399(2007).
RN   [5]
RX   PubMed=16641997; DOI=10.1038/nature04728;
RA   Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R.,
RA   Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R.,
RA   Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V.,
RA   Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.,
RA   Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B.,
RA   Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S.,
RA   Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q.,
RA   Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
RA   Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C.,
RA   Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G.,
RA   Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B.,
RA   Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R.,
RA   Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J.,
RA   Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A.,
RA   Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
RA   Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
RA   Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
RA   Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J.,
RA   Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H.,
RA   Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G.,
RA   Gibbs R.A.;
RT   "The DNA sequence, annotation and analysis of human chromosome 3.";
RL   Nature 440:1194-1198(2006).
RN   [6]
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
RN   [7]
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [8]
RX   PubMed=8700545;
RA   Ogawa S., Kurokawa M., Tanaka T., Mitani K., Inazawa J., Hangaishi A.,
RA   Tanaka K., Matsuo Y., Minowada J., Tsubota T., Yazaki Y., Hirai H.;
RT   "Structurally altered Evi-1 protein generated in the 3q21q26
RT   syndrome.";
RL   Oncogene 13:183-191(1996).
RN   [9]
RX   PubMed=9665135; DOI=10.1038/27945;
RA   Kurokawa M., Mitani K., Irie K., Matsuyama T., Takahashi T., Chiba S.,
RA   Yazaki Y., Matsumoto K., Hirai H.;
RT   "The oncoprotein Evi-1 represses TGF-beta signalling by inhibiting
RT   Smad3.";
RL   Nature 394:92-96(1998).
RN   [10]
RX   PubMed=10856240; DOI=10.1093/emboj/19.12.2958;
RA   Kurokawa M., Mitani K., Yamagata T., Takahashi T., Izutsu K.,
RA   Ogawa S., Moriguchi T., Nishida E., Yazaki Y., Hirai H.;
RT   "The evi-1 oncoprotein inhibits c-Jun N-terminal kinase and prevents
RT   stress-induced cell death.";
RL   EMBO J. 19:2958-2968(2000).
RN   [11]
RP   555-ASP-LEU-556 AND 586-ASP-LEU-587.
RX   PubMed=11568182; DOI=10.1074/jbc.M106733200;
RA   Chakraborty S., Senyuk V., Sitailo S., Chi Y., Nucifora G.;
RT   "Interaction of EVI1 with cAMP-responsive element-binding protein-
RT   binding protein (CBP) and p300/CBP-associated factor (P/CAF) results
RT   in reversible acetylation of EVI1 and in co-localization in nuclear
RT   speckles.";
RL   J. Biol. Chem. 276:44936-44943(2001).
RN   [12]
RX   PubMed=15897867; DOI=10.1038/sj.onc.1208754;
RA   Nitta E., Izutsu K., Yamaguchi Y., Imai Y., Ogawa S., Chiba S.,
RA   Kurokawa M., Hirai H.;
RT   "Oligomerization of Evi-1 regulated by the PR domain contributes to
RT   recruitment of corepressor CtBP.";
RL   Oncogene 24:6165-6173(2005).
RN   [13]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=17081983; DOI=10.1016/j.cell.2006.09.026;
RA   Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,
RA   Mann M.;
RT   "Global, in vivo, and site-specific phosphorylation dynamics in
RT   signaling networks.";
RL   Cell 127:635-648(2006).
RN   [14]
RX   PubMed=16462766; DOI=10.1038/sj.onc.1209403;
RA   Liu Y., Chen L., Ko T.C., Fields A.P., Thompson E.A.;
RT   "Evi1 is a survival factor which conveys resistance to both TGFbeta-
RT   and taxol-mediated cell death via PI3K/AKT.";
RL   Oncogene 25:3565-3575(2006).
RN   [15]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=18220336; DOI=10.1021/pr0705441;
RA   Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,
RA   Yates J.R. III;
RT   "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for
RT   efficient phosphoproteomic analysis.";
RL   J. Proteome Res. 7:1346-1351(2008).
RN   [16]
RX   PubMed=19767769; DOI=10.1038/onc.2009.288;
RA   Shimabe M., Goyama S., Watanabe-Okochi N., Yoshimi A., Ichikawa M.,
RA   Imai Y., Kurokawa M.;
RT   "Pbx1 is a downstream target of Evi-1 in hematopoietic
RT   stem/progenitors and leukemic cells.";
RL   Oncogene 28:4364-4374(2009).
RN   [17]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=20068231; DOI=10.1126/scisignal.2000475;
RA   Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
RA   Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
RA   Mann M.;
RT   "Quantitative phosphoproteomics reveals widespread full
RT   phosphorylation site occupancy during mitosis.";
RL   Sci. Signal. 3:RA3-RA3(2010).
RN   [18]
RP   LYS-533; LYS-547; LYS-564; LYS-599; LYS-948; LYS-953 AND LYS-973,
RX   PubMed=25218447; DOI=10.1038/nsmb.2890;
RA   Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M.,
RA   Vertegaal A.C.;
RT   "Uncovering global SUMOylation signaling networks in a site-specific
RT   manner.";
RL   Nat. Struct. Mol. Biol. 21:927-936(2014).
CC   -!- FUNCTION: Functions as a transcriptional regulator binding to DNA
CC       sequences in the promoter region of target genes and regulating
CC       positively or negatively their expression. Oncogene which plays a
CC       role in development, cell proliferation and differentiation. May
CC       also play a role in apoptosis through regulation of the JNK and
CC       TGF-beta signaling. Involved in hematopoiesis.
CC       {ECO:0000269|PubMed:10856240, ECO:0000269|PubMed:11568182,
CC       ECO:0000269|PubMed:15897867, ECO:0000269|PubMed:16462766,
CC       ECO:0000269|PubMed:19767769, ECO:0000269|PubMed:9665135}.
CC   -!- SUBUNIT: Homooligomer. Interacts with SUV39H1 (via SET domain);
CC       enhances MECOM transcriptional repression activity (By
CC       similarity). Interacts with CTBP1. Interacts with SMAD3 (via MH2
CC       domain); the interaction is direct. Interacts with SMAD4; through
CC       interaction with SMAD3. Interacts with CREBBP, KAT2B and histone
CC       deacetylases. Interacts with MAPK8 and MAPK9; inhibits JNK
CC       signaling. {ECO:0000250, ECO:0000269|PubMed:10856240,
CC       ECO:0000269|PubMed:11568182, ECO:0000269|PubMed:15897867,
CC       ECO:0000269|PubMed:9665135}.
CC       P56546:Ctbp2 (xeno); NbExp=3; IntAct=EBI-1384862, EBI-1384883;
CC       Q96EB6:SIRT1; NbExp=2; IntAct=EBI-1384862, EBI-1802965;
CC       Q9UBK9:UXT; NbExp=5; IntAct=EBI-1384862, EBI-357355;
CC   -!- SUBCELLULAR LOCATION: Nucleus. Nucleus speckle.
CC       Event=Alternative promoter usage, Alternative splicing; Named isoforms=6;
CC       Name=1; Synonyms=Long, Evi-1a;
CC         IsoId=Q03112-1; Sequence=Displayed;
CC       Name=2; Synonyms=Evi-1c, Mds1/Evi1;
CC         IsoId=Q03112-3; Sequence=VSP_038733;
CC         Note=Produced by alternative promoter usage. Contains an
CC         additional SET domain at positions 79-194. Unable to form
CC         homooligomers, to interact with CTBP1 and SMAD3 and to repress
CC         TGF-beta signaling. Contains a glycyl lysine isopeptide
CC         (Lys-Gly) (interchain with G-Cter in SUMO2) at position 190.
CC         {ECO:0000244|PubMed:25218447};
CC       Name=3; Synonyms=Mds1;
CC         IsoId=Q13465-1; Sequence=External;
CC         Note=Produced by alternative promoter usage.;
CC       Name=4;
CC         IsoId=Q03112-4; Sequence=VSP_038734, VSP_038735;
CC         Note=Contains a glycyl lysine isopeptide (Lys-Gly) (interchain
CC         with G-Cter in SUMO2) at position 66.
CC         {ECO:0000244|PubMed:25218447};
CC       Name=5;
CC         IsoId=Q03112-5; Sequence=VSP_038736;
CC       Name=6;
CC         IsoId=Q03112-6; Sequence=VSP_038735, VSP_038736;
CC   -!- DOMAIN: Both zinc finger regions are required for the
CC       transcriptional activation of PBX1.
CC   -!- PTM: Phosphorylated. {ECO:0000250}.
CC   -!- PTM: May be acetylated by CREBBP and KAT2B.
CC       {ECO:0000269|PubMed:11568182}.
CC   -!- DISEASE: Note=A chromosomal aberration involving EVI1 is a cause
CC       of chronic myelogenous leukemia (CML). Translocation
CC       t(3;21)(q26;q22) with RUNX1/AML1.
CC   -!- SIMILARITY: Contains 10 C2H2-type zinc fingers.
CC       {ECO:0000255|PROSITE-ProRule:PRU00042}.
CC       Sequence=AAB29907.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC       Sequence=AAB37456.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};
CC       Sequence=AAI30521.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC       Sequence=BAH14103.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; X54989; CAA38735.1; -; mRNA.
DR   EMBL; S69002; AAB29907.1; ALT_INIT; mRNA.
DR   EMBL; AK292865; BAF85554.1; -; mRNA.
DR   EMBL; AK304098; BAH14103.1; ALT_SEQ; mRNA.
DR   EMBL; BX640908; CAE45952.1; -; mRNA.
DR   EMBL; BX647613; CAI46086.1; -; mRNA.
DR   EMBL; AC007849; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC024099; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC069220; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC074033; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC078985; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471052; EAW78553.1; -; Genomic_DNA.
DR   EMBL; CH471052; EAW78556.1; -; Genomic_DNA.
DR   EMBL; CH471052; EAW78557.1; -; Genomic_DNA.
DR   EMBL; BC031019; AAH31019.1; -; mRNA.
DR   EMBL; BC130520; AAI30521.1; ALT_INIT; mRNA.
DR   EMBL; BC143951; AAI43952.1; -; mRNA.
DR   EMBL; BC143952; AAI43953.1; -; mRNA.
DR   EMBL; S82592; AAB37456.1; ALT_SEQ; mRNA.
DR   CCDS; CCDS3205.1; -. [Q03112-1]
DR   CCDS; CCDS54669.1; -. [Q03112-5]
DR   CCDS; CCDS54670.1; -. [Q03112-4]
DR   PIR; A60191; A60191.
DR   PIR; S41705; S41705.
DR   RefSeq; NP_001098547.3; NM_001105077.3. [Q03112-4]
DR   RefSeq; NP_001098548.2; NM_001105078.3. [Q03112-1]
DR   RefSeq; NP_001157471.1; NM_001163999.1. [Q03112-6]
DR   RefSeq; NP_001157472.1; NM_001164000.1. [Q03112-5]
DR   RefSeq; NP_001192123.1; NM_001205194.1. [Q03112-1]
DR   RefSeq; NP_004982.2; NM_004991.3. [Q03112-3]
DR   RefSeq; NP_005232.2; NM_005241.3. [Q03112-1]
DR   RefSeq; XP_005247276.1; XM_005247219.2.
DR   RefSeq; XP_005247277.1; XM_005247220.2.
DR   RefSeq; XP_005247278.1; XM_005247221.2.
DR   RefSeq; XP_005247280.1; XM_005247223.2. [Q03112-1]
DR   RefSeq; XP_011510849.1; XM_011512547.1. [Q03112-4]
DR   RefSeq; XP_011510850.1; XM_011512548.1. [Q03112-4]
DR   UniGene; Hs.744090; -.
DR   ProteinModelPortal; Q03112; -.
DR   SMR; Q03112; 19-237, 733-813.
DR   BioGrid; 108423; 21.
DR   DIP; DIP-38639N; -.
DR   IntAct; Q03112; 3.
DR   STRING; 9606.ENSP00000264674; -.
DR   PhosphoSite; Q03112; -.
DR   BioMuta; ARHGAP32; -.
DR   DMDM; 145559472; -.
DR   MaxQB; Q03112; -.
DR   PaxDb; Q03112; -.
DR   PRIDE; Q03112; -.
DR   DNASU; 2122; -.
DR   Ensembl; ENST00000264674; ENSP00000264674; ENSG00000085276. [Q03112-4]
DR   Ensembl; ENST00000464456; ENSP00000419770; ENSG00000085276. [Q03112-5]
DR   Ensembl; ENST00000468789; ENSP00000419995; ENSG00000085276. [Q03112-1]
DR   Ensembl; ENST00000628990; ENSP00000486104; ENSG00000085276. [Q03112-1]
DR   GeneID; 2122; -.
DR   KEGG; hsa:2122; -.
DR   UCSC; uc003ffi.3; human. [Q03112-1]
DR   UCSC; uc003ffj.3; human. [Q03112-4]
DR   UCSC; uc003ffk.2; human. [Q03112-5]
DR   UCSC; uc011bpi.1; human. [Q03112-6]
DR   UCSC; uc011bpj.1; human. [Q03112-3]
DR   CTD; 2122; -.
DR   GeneCards; MECOM; -.
DR   H-InvDB; HIX0003836; -.
DR   HPA; HPA046537; -.
DR   HPA; HPA052977; -.
DR   MIM; 165215; gene.
DR   neXtProt; NX_Q03112; -.
DR   Orphanet; 402020; 'Acute myeloid leukemia with inv3(p21;q26.2) or t(3;3)(p21;q26.2)'.
DR   Orphanet; 52688; Myelodysplastic syndrome.
DR   PharmGKB; PA27912; -.
DR   eggNOG; KOG1721; Eukaryota.
DR   eggNOG; COG5048; LUCA.
DR   GeneTree; ENSGT00530000063676; -.
DR   HOVERGEN; HBG005619; -.
DR   InParanoid; Q03112; -.
DR   KO; K04462; -.
DR   OrthoDB; EOG72G16H; -.
DR   PhylomeDB; Q03112; -.
DR   TreeFam; TF315309; -.
DR   Reactome; R-HSA-3214841; PKMTs methylate histone lysines.
DR   SignaLink; Q03112; -.
DR   ChiTaRS; MECOM; human.
DR   GeneWiki; MECOM; -.
DR   GenomeRNAi; 2122; -.
DR   NextBio; 8579; -.
DR   Proteomes; UP000005640; Chromosome 3.
DR   Bgee; Q03112; -.
DR   CleanEx; HS_EVI1; -.
DR   ExpressionAtlas; Q03112; baseline and differential.
DR   Genevisible; Q03112; HS.
DR   GO; GO:0016235; C:aggresome; IDA:HPA.
DR   GO; GO:0005737; C:cytoplasm; IDA:HPA.
DR   GO; GO:0005829; C:cytosol; TAS:Reactome.
DR   GO; GO:0005794; C:Golgi apparatus; IDA:HPA.
DR   GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
DR   GO; GO:0016607; C:nuclear speck; IDA:UniProtKB.
DR   GO; GO:0005654; C:nucleoplasm; IDA:HPA.
DR   GO; GO:0005634; C:nucleus; IDA:UniProtKB.
DR   GO; GO:0003677; F:DNA binding; ISS:UniProtKB.
DR   GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
DR   GO; GO:0042803; F:protein homodimerization activity; IDA:UniProtKB.
DR   GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; IDA:UniProtKB.
DR   GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
DR   GO; GO:0030154; P:cell differentiation; IEA:UniProtKB-KW.
DR   GO; GO:0006325; P:chromatin organization; TAS:Reactome.
DR   GO; GO:0035115; P:embryonic forelimb morphogenesis; IEA:Ensembl.
DR   GO; GO:0035116; P:embryonic hindlimb morphogenesis; IEA:Ensembl.
DR   GO; GO:0030900; P:forebrain development; IEA:Ensembl.
DR   GO; GO:0071425; P:hematopoietic stem cell proliferation; ISS:UniProtKB.
DR   GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
DR   GO; GO:0006954; P:inflammatory response; IEA:Ensembl.
DR   GO; GO:0046329; P:negative regulation of JNK cascade; IMP:UniProtKB.
DR   GO; GO:0043069; P:negative regulation of programmed cell death; IMP:UniProtKB.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
DR   GO; GO:0001780; P:neutrophil homeostasis; IEA:Ensembl.
DR   GO; GO:0060039; P:pericardium development; IEA:Ensembl.
DR   GO; GO:0090336; P:positive regulation of brown fat cell differentiation; IEA:Ensembl.
DR   GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IEA:Ensembl.
DR   GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
DR   GO; GO:0009791; P:post-embryonic development; IEA:Ensembl.
DR   GO; GO:0051726; P:regulation of cell cycle; IDA:UniProtKB.
DR   GO; GO:0042127; P:regulation of cell proliferation; IEA:Ensembl.
DR   GO; GO:0072001; P:renal system development; IEA:Ensembl.
DR   GO; GO:0009617; P:response to bacterium; IEA:Ensembl.
DR   GO; GO:0019827; P:stem cell population maintenance; IEA:Ensembl.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   Gene3D;; -; 8.
DR   InterPro; IPR030413; Evi1/Prdm16.
DR   InterPro; IPR007087; Znf_C2H2.
DR   InterPro; IPR015880; Znf_C2H2-like.
DR   InterPro; IPR013087; Znf_C2H2/integrase_DNA-bd.
DR   PANTHER; PTHR24393; PTHR24393; 1.
DR   Pfam; PF00096; zf-C2H2; 3.
DR   SMART; SM00355; ZnF_C2H2; 10.
DR   PROSITE; PS50157; ZINC_FINGER_C2H2_2; 10.
PE   1: Evidence at protein level;
KW   Acetylation; Alternative promoter usage; Alternative splicing;
KW   Apoptosis; Chromosomal rearrangement; Complete proteome;
KW   Developmental protein; Differentiation; DNA-binding; Isopeptide bond;
KW   Metal-binding; Nucleus; Phosphoprotein; Polymorphism; Proto-oncogene;
KW   Reference proteome; Repeat; Transcription; Transcription regulation;
KW   Ubl conjugation; Zinc; Zinc-finger.
FT   CHAIN         1   1051       MDS1 and EVI1 complex locus protein EVI1.
FT                                /FTId=PRO_0000047273.
FT   ZN_FING      21     44       C2H2-type 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING      75     97       C2H2-type 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     103    125       C2H2-type 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     131    154       C2H2-type 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     160    182       C2H2-type 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     188    210       C2H2-type 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     217    239       C2H2-type 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     733    755       C2H2-type 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     761    784       C2H2-type 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     790    812       C2H2-type 10. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   REGION        1    252       Interaction with MAPK9, SMAD3 and
FT                                probably SUV39H1.
FT   MOTIF       421    434       Nuclear localization signal.
FT                                {ECO:0000255}.
FT   MOTIF       553    557       CTBP-binding motif 1. {ECO:0000250}.
FT   MOTIF       584    588       CTBP-binding motif 2. {ECO:0000250}.
FT   COMPBIAS    886    937       Asp/Glu-rich (acidic).
FT   MOD_RES     436    436       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:P14404}.
FT   MOD_RES     552    552       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:P14404}.
FT   MOD_RES     860    860       Phosphoserine.
FT                                {ECO:0000244|PubMed:20068231}.
FT   CROSSLNK      2      2       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    367    367       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    497    497       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    533    533       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    547    547       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    564    564       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    599    599       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    948    948       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    953    953       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT   CROSSLNK    973    973       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO2).
FT                                {ECO:0000244|PubMed:25218447}.
FT                                HNLVACQINDQIFYRVVADIAPGEELLLFM (in
FT                                isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_038733.
FT                                NLVACQINDQIFYRVVADIAPGEELLLFM (in isoform
FT                                4). {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_038734.
FT   VAR_SEQ     138    138       K -> KQ (in isoform 4 and isoform 6).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_038735.
FT   VAR_SEQ     672    680       Missing (in isoform 5 and isoform 6).
FT                                {ECO:0000303|PubMed:15489334,
FT                                ECO:0000303|PubMed:17974005,
FT                                ECO:0000303|PubMed:8313895}.
FT                                /FTId=VSP_038736.
FT   VARIANT     107    107       Q -> R (in dbSNP:rs34896995).
FT                                /FTId=VAR_061928.
FT   MUTAGEN     555    556       DL->AS: Partial loss of interaction with
FT                                CTBP1. Loss of interaction with CTBP1;
FT                                when associated with 586-A-S-587.
FT                                {ECO:0000269|PubMed:11568182}.
FT   MUTAGEN     586    587       DL->AS: Partial loss of interaction with
FT                                CTBP1. Loss of interaction with CTBP1;
FT                                when associated with 555-A-S-556.
FT                                {ECO:0000269|PubMed:11568182}.
FT   CONFLICT     20     20       Q -> R (in Ref. 4; CAE45952).
FT                                {ECO:0000305}.
FT   CONFLICT    175    175       L -> P (in Ref. 4; CAE45952).
FT                                {ECO:0000305}.
FT   CONFLICT    301    301       F -> S (in Ref. 3; BAF85554).
FT                                {ECO:0000305}.
FT   CONFLICT    303    303       F -> V (in Ref. 1; CAA38735).
FT                                {ECO:0000305}.
FT   CONFLICT    443    443       S -> P (in Ref. 4; CAI46086).
FT                                {ECO:0000305}.
FT   CONFLICT    543    543       K -> R (in Ref. 4; CAE45952).
FT                                {ECO:0000305}.
FT   CONFLICT    730    730       K -> R (in Ref. 3; BAF85554).
FT                                {ECO:0000305}.
FT   CONFLICT    741    741       I -> V (in Ref. 4; CAI46086).
FT                                {ECO:0000305}.
FT   CONFLICT    796    796       D -> Y (in Ref. 1; CAA38735).
FT                                {ECO:0000305}.
FT   CONFLICT    875    875       D -> E (in Ref. 1; CAA38735).
FT                                {ECO:0000305}.
FT   CONFLICT    881    881       T -> P (in Ref. 1; CAA38735).
FT                                {ECO:0000305}.
FT   CONFLICT    906    906       N -> Y (in Ref. 1; CAA38735).
FT                                {ECO:0000305}.
FT   CONFLICT    992    992       V -> A (in Ref. 3; BAF85554).
FT                                {ECO:0000305}.
FT   CONFLICT   1013   1013       L -> P (in Ref. 4; CAE45952).
FT                                {ECO:0000305}.
SQ   SEQUENCE   1051 AA;  118276 MW;  BD132C53EA08D263 CRC64;
ID   FOG1_HUMAN              Reviewed;        1006 AA.
AC   Q8IX07;
DT   15-MAR-2004, integrated into UniProtKB/Swiss-Prot.
DT   18-MAY-2010, sequence version 2.
DT   11-NOV-2015, entry version 120.
DE   RecName: Full=Zinc finger protein ZFPM1;
DE   AltName: Full=Friend of GATA protein 1;
DE            Short=FOG-1;
DE            Short=Friend of GATA 1;
DE   AltName: Full=Zinc finger protein 89A;
DE   AltName: Full=Zinc finger protein multitype 1;
GN   Name=ZFPM1; Synonyms=FOG1, ZFN89A;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Megakaryocyte;
RX   PubMed=12483298; DOI=10.1007/s00439-002-0832-1;
RA   Freson K., Thys C., Wittewrongel C., Vermylen J., Hoylaerts M.F.,
RA   Van Geet C.;
RT   "Molecular cloning and characterization of the GATA1 cofactor human
RT   FOG1 and assessment of its binding to GATA1 proteins carrying D218
RT   substitutions.";
RL   Hum. Genet. 112:42-49(2003).
RN   [2]
RX   PubMed=15616553; DOI=10.1038/nature03187;
RA   Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X.,
RA   Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A.,
RA   Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.,
RA   Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L.,
RA   Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A.,
RA   Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D.,
RA   Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J.,
RA   Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M.,
RA   Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I.,
RA   Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W.,
RA   Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A.,
RA   Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S.,
RA   Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J.,
RA   Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D.,
RA   Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L.,
RA   Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A.,
RA   Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L.,
RA   Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N.,
RA   Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M.,
RA   Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L.,
RA   Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D.,
RA   Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P.,
RA   Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M.,
RA   Rubin E.M., Pennacchio L.A.;
RT   "The sequence and analysis of duplication-rich human chromosome 16.";
RL   Nature 432:988-994(2004).
RN   [3]
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RC   TISSUE=Prostate cancer;
RX   PubMed=17487921; DOI=10.1002/elps.200600782;
RA   Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S.;
RT   "Toward a global characterization of the phosphoproteome in prostate
RT   cancer cells: identification of phosphoproteins in the LNCaP cell
RT   line.";
RL   Electrophoresis 28:2027-2034(2007).
RN   [5]
RC   TISSUE=Embryonic kidney;
RX   PubMed=17525332; DOI=10.1126/science.1140321;
RA   Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,
RA   Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,
RA   Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
RT   "ATM and ATR substrate analysis reveals extensive protein networks
RT   responsive to DNA damage.";
RL   Science 316:1160-1166(2007).
RN   [6]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=18669648; DOI=10.1073/pnas.0805139105;
RA   Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
RA   Elledge S.J., Gygi S.P.;
RT   "A quantitative atlas of mitotic phosphorylation.";
RL   Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
RN   [7]
RX   PubMed=19413330; DOI=10.1021/ac9004309;
RA   Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
RA   Mohammed S.;
RT   "Lys-N and trypsin cover complementary parts of the phosphoproteome in
RT   a refined SCX-based approach.";
RL   Anal. Chem. 81:4493-4501(2009).
RN   [8]
RC   TISSUE=Leukemic T-cell;
RX   PubMed=19690332; DOI=10.1126/scisignal.2000007;
RA   Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
RA   Rodionov V., Han D.K.;
RT   "Quantitative phosphoproteomic analysis of T cell receptor signaling
RT   reveals system-wide modulation of protein-protein interactions.";
RL   Sci. Signal. 2:RA46-RA46(2009).
RN   [9]
RC   TISSUE=Liver;
RX   PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
RA   Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
RA   Wang L., Ye M., Zou H.;
RT   "An enzyme assisted RP-RPLC approach for in-depth analysis of human
RT   liver phosphoproteome.";
RL   J. Proteomics 96:253-262(2014).
CC   -!- FUNCTION: Transcription regulator that plays an essential role in
CC       erythroid and megakaryocytic cell differentiation. Essential
CC       cofactor that acts via the formation of a heterodimer with
CC       transcription factors of the GATA family GATA1, GATA2 and GATA3.
CC       Such heterodimer can both activate or repress transcriptional
CC       activity, depending on the cell and promoter context. The
CC       heterodimer formed with GATA proteins is essential to activate
CC       expression of genes such as NFE2, ITGA2B, alpha- and beta-globin,
CC       while it represses expression of KLF1. May be involved in
CC       regulation of some genes in gonads. May also be involved in
CC       cardiac development, in a non-redundant way with ZFPM2/FOG2 (By
CC       similarity). {ECO:0000250}.
CC   -!- SUBUNIT: Interacts with corepressor CTBP2; this interaction is
CC       however not essential for corepressor activity (By similarity).
CC       Interacts with the N-terminal zinc-finger of GATA1, GATA2 and
CC       probably GATA3. {ECO:0000250, ECO:0000269|PubMed:12483298}.
CC       P49841:GSK3B; NbExp=2; IntAct=EBI-3942619, EBI-373586;
CC       Q09028:RBBP4; NbExp=4; IntAct=EBI-3942619, EBI-620823;
CC   -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250}.
CC   -!- TISSUE SPECIFICITY: Mainly expressed in hematopoietic tissues.
CC       Also expressed in adult cerebellum, stomach, lymph node, liver and
CC       pancreas. Expressed in fetal heart, liver and spleen.
CC       {ECO:0000269|PubMed:12483298}.
CC   -!- DOMAIN: The CCHC-type zinc fingers 1, 5, 6 and 9 directly bind to
CC       GATA-type zinc fingers. The Tyr residue adjacent to the last Cys
CC       of the CCHC-type zinc finger is essential for the interaction with
CC       GATA-type zinc fingers (By similarity). {ECO:0000250}.
CC   -!- SIMILARITY: Belongs to the FOG (Friend of GATA) family.
CC       {ECO:0000305}.
CC   -!- SIMILARITY: Contains 4 C2H2-type zinc fingers.
CC       {ECO:0000255|PROSITE-ProRule:PRU00042}.
CC   -!- SIMILARITY: Contains 5 C2HC-type zinc fingers. {ECO:0000305}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF488691; AAN45858.1; -; mRNA.
DR   EMBL; AC116552; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC135049; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471184; EAW66806.1; -; Genomic_DNA.
DR   CCDS; CCDS32502.1; -.
DR   RefSeq; NP_722520.2; NM_153813.2.
DR   UniGene; Hs.632218; -.
DR   PDB; 2XU7; X-ray; 1.90 A; C/D=1-15.
DR   PDBsum; 2XU7; -.
DR   ProteinModelPortal; Q8IX07; -.
DR   SMR; Q8IX07; 85-209, 315-347.
DR   BioGrid; 127806; 10.
DR   DIP; DIP-48415N; -.
DR   IntAct; Q8IX07; 3.
DR   STRING; 9606.ENSP00000326630; -.
DR   PhosphoSite; Q8IX07; -.
DR   BioMuta; ZFPM1; -.
DR   DMDM; 296434508; -.
DR   MaxQB; Q8IX07; -.
DR   PaxDb; Q8IX07; -.
DR   PRIDE; Q8IX07; -.
DR   Ensembl; ENST00000319555; ENSP00000326630; ENSG00000179588.
DR   GeneID; 161882; -.
DR   KEGG; hsa:161882; -.
DR   UCSC; uc002fkv.3; human.
DR   CTD; 161882; -.
DR   GeneCards; ZFPM1; -.
DR   HGNC; HGNC:19762; ZFPM1.
DR   HPA; HPA046603; -.
DR   MIM; 601950; gene.
DR   neXtProt; NX_Q8IX07; -.
DR   PharmGKB; PA134920282; -.
DR   eggNOG; KOG1721; Eukaryota.
DR   eggNOG; COG5048; LUCA.
DR   GeneTree; ENSGT00530000063823; -.
DR   HOGENOM; HOG000112626; -.
DR   HOVERGEN; HBG101018; -.
DR   InParanoid; Q8IX07; -.
DR   KO; K17441; -.
DR   OrthoDB; EOG74TWXR; -.
DR   PhylomeDB; Q8IX07; -.
DR   TreeFam; TF331342; -.
DR   Reactome; R-HSA-983231; Factors involved in megakaryocyte development and platelet production.
DR   ChiTaRS; ZFPM1; human.
DR   GeneWiki; ZFPM1; -.
DR   GenomeRNAi; 161882; -.
DR   NextBio; 88126; -.
DR   PRO; PR:Q8IX07; -.
DR   Proteomes; UP000005640; Chromosome 16.
DR   Bgee; Q8IX07; -.
DR   CleanEx; HS_ZFPM1; -.
DR   ExpressionAtlas; Q8IX07; baseline and differential.
DR   Genevisible; Q8IX07; HS.
DR   GO; GO:0005737; C:cytoplasm; IEA:Ensembl.
DR   GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
DR   GO; GO:0005634; C:nucleus; IBA:GO_Central.
DR   GO; GO:0005667; C:transcription factor complex; IDA:BHF-UCL.
DR   GO; GO:0017053; C:transcriptional repressor complex; IDA:BHF-UCL.
DR   GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
DR   GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
DR   GO; GO:0001085; F:RNA polymerase II transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0008134; F:transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:BHF-UCL.
DR   GO; GO:0060413; P:atrial septum morphogenesis; ISS:BHF-UCL.
DR   GO; GO:0003181; P:atrioventricular valve morphogenesis; ISS:BHF-UCL.
DR   GO; GO:0007596; P:blood coagulation; TAS:Reactome.
DR   GO; GO:0055008; P:cardiac muscle tissue morphogenesis; ISS:BHF-UCL.
DR   GO; GO:0060318; P:definitive erythrocyte differentiation; IEA:Ensembl.
DR   GO; GO:0035162; P:embryonic hemopoiesis; ISS:BHF-UCL.
DR   GO; GO:0030218; P:erythrocyte differentiation; ISS:BHF-UCL.
DR   GO; GO:0030851; P:granulocyte differentiation; IEA:Ensembl.
DR   GO; GO:0007507; P:heart development; IBA:GO_Central.
DR   GO; GO:0035855; P:megakaryocyte development; IEA:Ensembl.
DR   GO; GO:0030219; P:megakaryocyte differentiation; ISS:BHF-UCL.
DR   GO; GO:0003192; P:mitral valve formation; ISS:BHF-UCL.
DR   GO; GO:0045599; P:negative regulation of fat cell differentiation; ISS:BHF-UCL.
DR   GO; GO:0045403; P:negative regulation of interleukin-4 biosynthetic process; IDA:BHF-UCL.
DR   GO; GO:0060377; P:negative regulation of mast cell differentiation; ISS:BHF-UCL.
DR   GO; GO:0032091; P:negative regulation of protein binding; ISS:BHF-UCL.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:GOC.
DR   GO; GO:0003151; P:outflow tract morphogenesis; ISS:BHF-UCL.
DR   GO; GO:0030220; P:platelet formation; IGI:BHF-UCL.
DR   GO; GO:0045078; P:positive regulation of interferon-gamma biosynthetic process; IDA:BHF-UCL.
DR   GO; GO:0060319; P:primitive erythrocyte differentiation; IEA:Ensembl.
DR   GO; GO:0032642; P:regulation of chemokine production; IEA:Ensembl.
DR   GO; GO:0010724; P:regulation of definitive erythrocyte differentiation; IDA:BHF-UCL.
DR   GO; GO:0002295; P:T-helper cell lineage commitment; IC:BHF-UCL.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0071733; P:transcriptional activation by promoter-enhancer looping; ISS:BHF-UCL.
DR   GO; GO:0003195; P:tricuspid valve formation; ISS:BHF-UCL.
DR   GO; GO:0060412; P:ventricular septum morphogenesis; ISS:BHF-UCL.
DR   Gene3D;; -; 2.
DR   InterPro; IPR007087; Znf_C2H2.
DR   InterPro; IPR015880; Znf_C2H2-like.
DR   InterPro; IPR013087; Znf_C2H2/integrase_DNA-bd.
DR   SMART; SM00355; ZnF_C2H2; 9.
PE   1: Evidence at protein level;
KW   3D-structure; Activator; Complete proteome; DNA-binding;
KW   Metal-binding; Nucleus; Phosphoprotein; Polymorphism;
KW   Reference proteome; Repeat; Repressor; Transcription;
KW   Transcription regulation; Zinc; Zinc-finger.
FT   CHAIN         1   1006       Zinc finger protein ZFPM1.
FT                                /FTId=PRO_0000221041.
FT   ZN_FING     241    264       C2HC-type 1.
FT   ZN_FING     290    314       C2H2-type 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     320    342       C2H2-type 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     348    371       C2H2-type 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     577    699       C2HC-type 2.
FT   ZN_FING     683    705       C2HC-type 3.
FT   ZN_FING     817    839       C2HC-type 4.
FT   ZN_FING     854    877       C2H2-type 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     974   1000       C2HC-type 5.
FT   REGION      330    341       Interaction with TACC3. {ECO:0000250}.
FT   REGION      794    800       Interaction with CTBP2. {ECO:0000250}.
FT   MOD_RES     128    128       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O35615}.
FT   MOD_RES     272    272       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O35615}.
FT   MOD_RES     491    491       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O35615}.
FT   MOD_RES     494    494       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O35615}.
FT   MOD_RES     671    671       Phosphoserine.
FT                                {ECO:0000244|PubMed:24275569}.
FT   MOD_RES     786    786       Phosphoserine.
FT                                {ECO:0000244|PubMed:18669648,
FT                                ECO:0000244|PubMed:24275569}.
FT   MOD_RES     901    901       Phosphoserine.
FT                                {ECO:0000244|PubMed:19690332,
FT                                ECO:0000244|PubMed:24275569}.
FT   MOD_RES     909    909       Phosphoserine.
FT                                {ECO:0000244|PubMed:19690332}.
FT   MOD_RES     914    914       Phosphoserine.
FT                                {ECO:0000244|PubMed:24275569}.
FT   MOD_RES     935    935       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O35615}.
FT   VARIANT      70     70       G -> A (in dbSNP:rs34916016).
FT                                /FTId=VAR_057491.
FT   CONFLICT     22     22       R -> G (in Ref. 1; AAN45858).
FT                                {ECO:0000305}.
FT   CONFLICT    444    447       EPLA -> AP (in Ref. 1; AAN45858).
FT                                {ECO:0000305}.
SQ   SEQUENCE   1006 AA;  104888 MW;  E9C2363503A64898 CRC64;
ID   FOG2_HUMAN              Reviewed;        1151 AA.
AC   Q8WW38; Q32MA6; Q9NPL7; Q9NPS4; Q9UNI5;
DT   15-MAR-2004, integrated into UniProtKB/Swiss-Prot.
DT   20-FEB-2007, sequence version 3.
DT   11-NOV-2015, entry version 116.
DE   RecName: Full=Zinc finger protein ZFPM2;
DE   AltName: Full=Friend of GATA protein 2;
DE            Short=FOG-2;
DE            Short=Friend of GATA 2;
DE            Short=hFOG-2;
DE   AltName: Full=Zinc finger protein 89B;
DE   AltName: Full=Zinc finger protein multitype 2;
GN   Name=ZFPM2; Synonyms=FOG2, ZNF89B;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Erythroleukemia;
RX   PubMed=10438528; DOI=10.1074/jbc.274.33.23491;
RA   Holmes M., Turner J., Fox A.H., Chisholm O., Crossley M., Chong B.;
RT   "hFOG-2, a novel zinc finger protein, binds the co-repressor mCtBP2
RT   and modulates GATA-mediated activation.";
RL   J. Biol. Chem. 274:23491-23498(1999).
RN   [2]
RC   TISSUE=Prostate;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [3]
RG   The European IMAGE consortium;
RL   Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RX   PubMed=23226341; DOI=10.1371/journal.pone.0050637;
RA   Perdomo J., Jiang X.M., Carter D.R., Khachigian L.M., Chong B.H.;
RT   "SUMOylation regulates the transcriptional repression activity of FOG-
RT   2 and its association with GATA-4.";
RL   PLoS ONE 7:E50637-E50637(2012).
RN   [5]
RX   PubMed=24549039; DOI=10.1093/hmg/ddu074;
RA   Bashamboo A., Brauner R., Bignon-Topalovic J., Lortat-Jacob S.,
RA   Karageorgou V., Lourenco D., Guffanti A., McElreavey K.;
RT   "Mutations in the FOG2/ZFPM2 gene are associated with anomalies of
RT   human testis determination.";
RL   Hum. Mol. Genet. 23:3657-3665(2014).
RN   [6]
RP   GLY-30 AND GLY-657.
RX   PubMed=14517948; DOI=10.1002/humu.10261;
RA   Pizzuti A., Sarkozy A., Newton A.L., Conti E., Flex E., Digilio M.C.,
RA   Amati F., Gianni D., Tandoi C., Marino B., Crossley M.,
RA   Dallapiccola B.;
RT   "Mutations of ZFPM2/FOG2 gene in sporadic cases of tetralogy of
RT   Fallot.";
RL   Hum. Mutat. 22:372-377(2003).
RN   [7]
RX   PubMed=16103912; DOI=10.1371/journal.pgen.0010010;
RA   Ackerman K.G., Herron B.J., Vargas S.O., Huang H., Tevosian S.G.,
RA   Kochilas L., Rao C., Pober B.R., Babiuk R.P., Epstein J.A.,
RA   Greer J.J., Beier D.R.;
RT   "Fog2 is required for normal diaphragm and lung development in mice
RT   and humans.";
RL   PLoS Genet. 1:58-65(2005).
RN   [8]
RX   PubMed=20807224; DOI=10.1111/j.1399-0004.2010.01523.x;
RA   De Luca A., Sarkozy A., Ferese R., Consoli F., Lepri F., Dentici M.L.,
RA   Vergara P., De Zorzi A., Versacci P., Digilio M.C., Marino B.,
RA   Dallapiccola B.;
RT   "New mutations in ZFPM2/FOG2 gene in tetralogy of Fallot and double
RT   outlet right ventricle.";
RL   Clin. Genet. 80:184-190(2011).
CC   -!- FUNCTION: Transcription regulator that plays a central role in
CC       heart morphogenesis and development of coronary vessels from
CC       epicardium, by regulating genes that are essential during
CC       cardiogenesis. Essential cofactor that acts via the formation of a
CC       heterodimer with transcription factors of the GATA family GATA4,
CC       GATA5 and GATA6. Such heterodimer can both activate or repress
CC       transcriptional activity, depending on the cell and promoter
CC       context. Also required in gonadal differentiation, possibly be
CC       regulating expression of SRY. Probably acts a corepressor of NR2F2
CC       (By similarity). {ECO:0000250}.
CC   -!- SUBUNIT: Interacts with the N-terminal zinc-finger of GATA4, GATA5
CC       and probably GATA6. Interacts with retinoid nuclear receptor RXRA
CC       when ligand bound (By similarity). Interacts with corepressor
CC       CTBP2; this interaction is however not essential for corepressor
CC       activity. Able to bind GATA1 in vitro. Interacts with NR2F2 and
CC       NR2F6 (By similarity). Interacts with ATOH8; mediates indirect
CC       interaction with GATA4 (By similarity).
CC       {ECO:0000250|UniProtKB:Q8WW38, ECO:0000269|PubMed:10438528,
CC       ECO:0000269|PubMed:24549039}.
CC   -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:23226341}.
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q8WW38-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q8WW38-2; Sequence=VSP_009701, VSP_009702;
CC         Note=Sequence incomplete. No experimental confirmation
CC         available.;
CC   -!- TISSUE SPECIFICITY: Widely expressed at low level.
CC       {ECO:0000269|PubMed:10438528}.
CC   -!- DOMAIN: The CCHC-type zinc fingers 1, 5, 6 and 8 directly bind to
CC       GATA-type zinc fingers. The Tyr residue adjacent to the last Cys
CC       of the CCHC-type zinc finger is essential for the interaction with
CC       GATA-type zinc fingers (By similarity). {ECO:0000250}.
CC   -!- PTM: Sumoylation reduces transcriptional repression activity.
CC       {ECO:0000269|PubMed:23226341}.
CC   -!- DISEASE: Tetralogy of Fallot (TOF) [MIM:187500]: A congenital
CC       heart anomaly which consists of pulmonary stenosis, ventricular
CC       septal defect, dextroposition of the aorta (aorta is on the right
CC       side instead of the left) and hypertrophy of the right ventricle.
CC       In this condition, blood from both ventricles (oxygen-rich and
CC       oxygen-poor) is pumped into the body often causing cyanosis.
CC       {ECO:0000269|PubMed:14517948, ECO:0000269|PubMed:20807224}.
CC       Note=The disease may be caused by mutations affecting the gene
CC       represented in this entry.
CC   -!- DISEASE: Diaphragmatic hernia 3 (DIH3) [MIM:610187]: Form of
CC       congenital diaphragmatic hernia (CDH). CDH refers to a group of
CC       congenital defects in the structural integrity of the diaphragm
CC       associated with often lethal pulmonary hypoplasia and pulmonary
CC       hypertension. {ECO:0000269|PubMed:16103912}. Note=The disease is
CC       caused by mutations affecting the gene represented in this entry.
CC   -!- DISEASE: 46,XY sex reversal 9 (SRXY9) [MIM:616067]: A disorder of
CC       sex development. Affected individuals have a 46,XY karyotype but
CC       present as phenotypically normal females or have ambiguous
CC       external genitalia. {ECO:0000269|PubMed:24549039}. Note=The
CC       disease is caused by mutations affecting the gene represented in
CC       this entry.
CC   -!- DISEASE: Conotruncal heart malformations (CTHM) [MIM:217095]: A
CC       group of congenital heart defects involving the outflow tracts.
CC       Examples include truncus arteriosus communis, double-outlet right
CC       ventricle and transposition of great arteries. Truncus arteriosus
CC       communis is characterized by a single outflow tract instead of a
CC       separate aorta and pulmonary artery. In transposition of the great
CC       arteries, the aorta arises from the right ventricle and the
CC       pulmonary artery from the left ventricle. In double outlet of the
CC       right ventricle, both the pulmonary artery and aorta arise from
CC       the right ventricle. {ECO:0000269|PubMed:20807224}. Note=The
CC       disease is caused by mutations affecting the gene represented in
CC       this entry.
CC   -!- SIMILARITY: Belongs to the FOG (Friend of GATA) family.
CC       {ECO:0000305}.
CC   -!- SIMILARITY: Contains 3 C2H2-type zinc fingers.
CC       {ECO:0000255|PROSITE-ProRule:PRU00042}.
CC   -!- SIMILARITY: Contains 5 C2HC-type zinc fingers. {ECO:0000305}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF119334; AAD49558.1; -; mRNA.
DR   EMBL; BC020928; AAH20928.1; -; mRNA.
DR   EMBL; BC109222; AAI09223.1; -; mRNA.
DR   EMBL; AL389987; CAB97539.1; -; mRNA.
DR   EMBL; AL389989; CAB97541.1; -; mRNA.
DR   CCDS; CCDS47908.1; -. [Q8WW38-1]
DR   RefSeq; NP_036214.2; NM_012082.3. [Q8WW38-1]
DR   UniGene; Hs.431009; -.
DR   ProteinModelPortal; Q8WW38; -.
DR   SMR; Q8WW38; 251-276, 290-325, 352-395, 548-574, 687-713, 1112-1145.
DR   BioGrid; 116986; 14.
DR   IntAct; Q8WW38; 2.
DR   STRING; 9606.ENSP00000384179; -.
DR   PhosphoSite; Q8WW38; -.
DR   BioMuta; ZFPM2; -.
DR   DMDM; 126302543; -.
DR   MaxQB; Q8WW38; -.
DR   PaxDb; Q8WW38; -.
DR   PRIDE; Q8WW38; -.
DR   Ensembl; ENST00000407775; ENSP00000384179; ENSG00000169946. [Q8WW38-1]
DR   GeneID; 23414; -.
DR   KEGG; hsa:23414; -.
DR   UCSC; uc003ymd.3; human. [Q8WW38-1]
DR   CTD; 23414; -.
DR   GeneCards; ZFPM2; -.
DR   HGNC; HGNC:16700; ZFPM2.
DR   HPA; HPA004094; -.
DR   MIM; 187500; phenotype.
DR   MIM; 217095; phenotype.
DR   MIM; 603693; gene.
DR   MIM; 610187; phenotype.
DR   MIM; 616067; phenotype.
DR   neXtProt; NX_Q8WW38; -.
DR   Orphanet; 251510; 46,XY partial gonadal dysgenesis.
DR   Orphanet; 2140; Congenital diaphragmatic hernia.
DR   Orphanet; 3303; Tetralogy of Fallot.
DR   PharmGKB; PA134947303; -.
DR   eggNOG; KOG1721; Eukaryota.
DR   eggNOG; COG5048; LUCA.
DR   GeneTree; ENSGT00530000063823; -.
DR   HOGENOM; HOG000057275; -.
DR   HOVERGEN; HBG048953; -.
DR   InParanoid; Q8WW38; -.
DR   KO; K17442; -.
DR   OrthoDB; EOG74TWXR; -.
DR   PhylomeDB; Q8WW38; -.
DR   TreeFam; TF331342; -.
DR   Reactome; R-HSA-983231; Factors involved in megakaryocyte development and platelet production.
DR   ChiTaRS; ZFPM2; human.
DR   GeneWiki; ZFPM2; -.
DR   GenomeRNAi; 23414; -.
DR   NextBio; 45615; -.
DR   PRO; PR:Q8WW38; -.
DR   Proteomes; UP000005640; Chromosome 8.
DR   Bgee; Q8WW38; -.
DR   CleanEx; HS_ZFPM2; -.
DR   ExpressionAtlas; Q8WW38; baseline and differential.
DR   Genevisible; Q8WW38; HS.
DR   GO; GO:0005737; C:cytoplasm; IEA:Ensembl.
DR   GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
DR   GO; GO:0005634; C:nucleus; IBA:GO_Central.
DR   GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
DR   GO; GO:0001105; F:RNA polymerase II transcription coactivator activity; NAS:BHF-UCL.
DR   GO; GO:0001085; F:RNA polymerase II transcription factor binding; IBA:GO_Central.
DR   GO; GO:0003714; F:transcription corepressor activity; IDA:BHF-UCL.
DR   GO; GO:0008134; F:transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding; IBA:GO_Central.
DR   GO; GO:0008270; F:zinc ion binding; NAS:BHF-UCL.
DR   GO; GO:0007596; P:blood coagulation; TAS:Reactome.
DR   GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
DR   GO; GO:0048568; P:embryonic organ development; IEA:Ensembl.
DR   GO; GO:0007506; P:gonadal mesoderm development; IEA:UniProtKB-KW.
DR   GO; GO:0007507; P:heart development; IBA:GO_Central.
DR   GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
DR   GO; GO:0030324; P:lung development; IEA:Ensembl.
DR   GO; GO:0060548; P:negative regulation of cell death; IEA:Ensembl.
DR   GO; GO:0045599; P:negative regulation of fat cell differentiation; IMP:UniProtKB.
DR   GO; GO:2000195; P:negative regulation of female gonad development; IEA:Ensembl.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IBA:GO_Central.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
DR   GO; GO:0003148; P:outflow tract septum morphogenesis; IMP:BHF-UCL.
DR   GO; GO:2000020; P:positive regulation of male gonad development; IEA:Ensembl.
DR   GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:BHF-UCL.
DR   GO; GO:0003221; P:right ventricular cardiac muscle tissue morphogenesis; IMP:BHF-UCL.
DR   GO; GO:0001570; P:vasculogenesis; IEA:Ensembl.
DR   GO; GO:0060412; P:ventricular septum morphogenesis; IMP:BHF-UCL.
DR   Gene3D;; -; 1.
DR   InterPro; IPR007087; Znf_C2H2.
DR   InterPro; IPR015880; Znf_C2H2-like.
DR   InterPro; IPR013087; Znf_C2H2/integrase_DNA-bd.
DR   SMART; SM00355; ZnF_C2H2; 8.
PE   1: Evidence at protein level;
KW   Activator; Alternative splicing; Cardiomyopathy; Complete proteome;
KW   Differentiation; Disease mutation; DNA-binding;
KW   Gonadal differentiation; Isopeptide bond; Metal-binding; Nucleus;
KW   Polymorphism; Reference proteome; Repeat; Repressor; Transcription;
KW   Transcription regulation; Ubl conjugation; Zinc; Zinc-finger.
FT   CHAIN         1   1151       Zinc finger protein ZFPM2.
FT                                /FTId=PRO_0000221043.
FT   ZN_FING     250    273       C2HC-type 1.
FT   ZN_FING     296    320       C2H2-type 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     335    357       C2H2-type 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     363    385       C2H2-type 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00042}.
FT   ZN_FING     548    571       C2HC-type 2.
FT   ZN_FING     687    710       C2HC-type 3.
FT   ZN_FING     854    877       C2HC-type 4.
FT   ZN_FING    1119   1142       C2HC-type 5.
FT   REGION      829    835       Interaction with CTBP2. {ECO:0000305}.
FT   MOTIF       736    740       Nuclear localization signal.
FT                                {ECO:0000250}.
FT   CROSSLNK    324    324       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO1).
FT   CROSSLNK    471    471       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO1).
FT   CROSSLNK    915    915       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO1).
FT   CROSSLNK    955    955       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO1).
FT   VAR_SEQ       1    132       Missing (in isoform 2).
FT                                {ECO:0000303|Ref.3}.
FT                                /FTId=VSP_009701.
FT                                KKK (in isoform 2). {ECO:0000303|Ref.3}.
FT                                /FTId=VSP_009702.
FT   VARIANT      30     30       E -> G (in TOF and CTHM; does not affect
FT                                its ability to interact with GATA4;
FT                                dbSNP:rs121908601).
FT                                {ECO:0000269|PubMed:14517948,
FT                                ECO:0000269|PubMed:20807224}.
FT                                /FTId=VAR_017942.
FT   VARIANT     227    227       I -> V (in CTHM).
FT                                {ECO:0000269|PubMed:20807224}.
FT                                /FTId=VAR_072074.
FT   VARIANT     260    260       R -> Q (in SRXY9; results in reduced
FT                                transactivation activity on the AMH
FT                                promoter; does not affect its ability to
FT                                interact with GATA4).
FT                                {ECO:0000269|PubMed:24549039}.
FT                                /FTId=VAR_071104.
FT   VARIANT     402    402       S -> R (in SRXY9; results in reduced
FT                                transactivation activity on the AMH
FT                                promoter; abolished its ability to
FT                                interact with GATA4).
FT                                {ECO:0000269|PubMed:24549039}.
FT                                /FTId=VAR_071105.
FT   VARIANT     403    403       A -> G (in dbSNP:rs11993776).
FT                                {ECO:0000269|PubMed:24549039}.
FT                                /FTId=VAR_024178.
FT   VARIANT     544    544       M -> I (in SRXY9 and TOF; reduced its
FT                                ability to interact with GATA4).
FT                                {ECO:0000269|PubMed:20807224,
FT                                ECO:0000269|PubMed:24549039}.
FT                                /FTId=VAR_072075.
FT   VARIANT     657    657       S -> G (in TOF; slightly impairs its
FT                                ability to interact with GATA4;
FT                                dbSNP:rs28374544).
FT                                {ECO:0000269|PubMed:14517948}.
FT                                /FTId=VAR_017943.
FT   VARIANT     782    782       E -> D (in dbSNP:rs2920048).
FT                                {ECO:0000269|PubMed:24549039}.
FT                                /FTId=VAR_017944.
FT   VARIANT    1055   1055       A -> V (in dbSNP:rs16873741).
FT                                /FTId=VAR_030760.
FT   CONFLICT    198    198       F -> L (in Ref. 3; CAB97541).
FT                                {ECO:0000305}.
FT   CONFLICT    939    939       L -> P (in Ref. 1; AAD49558).
FT                                {ECO:0000305}.
SQ   SEQUENCE   1151 AA;  128159 MW;  680E31BA1D044C35 CRC64;
ID   HAIR_DROME              Reviewed;         337 AA.
AC   P14003; A4V1N7; Q95NH3; Q95NU9; Q9VSN8;
DT   01-JAN-1990, integrated into UniProtKB/Swiss-Prot.
DT   18-APR-2006, sequence version 2.
DT   11-NOV-2015, entry version 154.
DE   RecName: Full=Protein hairy;
GN   Name=h; ORFNames=CG6494;
OS   Drosophila melanogaster (Fruit fly).
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
OC   Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;
OC   Ephydroidea; Drosophilidae; Drosophila; Sophophora.
OX   NCBI_TaxID=7227;
RN   [1]
RC   STRAIN=Oregon-R;
RX   PubMed=2479541;
RA   Rushlow C.A., Hogan A., Pierchin S.M., Howe K.M., Lardelli M.,
RA   Ish-Horowicz D.;
RT   "The Drosophila hairy protein acts in both segmentation and bristle
RT   patterning and shows homology to N-myc.";
RL   EMBO J. 8:3095-3103(1989).
RN   [2]
RC   STRAIN=R3-105, R3-107, R3-19, R3-2, R3-24, R3-48, R3-53, R3-6, R3-74,
RC   and R3-95;
RX   PubMed=12242230;
RA   Robin C., Lyman R.F., Long A.D., Langley C.H., Mackay T.F.C.;
RT   "hairy. A quantitative trait locus for Drosophila sensory bristle
RT   number.";
RL   Genetics 162:155-164(2002).
RN   [3]
RC   STRAIN=Berkeley;
RX   PubMed=10731132; DOI=10.1126/science.287.5461.2185;
RA   Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
RA   Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
RA   George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
RA   Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
RA   Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
RA   Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
RA   Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
RA   Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
RA   Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
RA   Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
RA   Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
RA   Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
RA   de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
RA   Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
RA   Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
RA   Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
RA   Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
RA   Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
RA   Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
RA   Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
RA   Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
RA   Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
RA   Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
RA   Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
RA   Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
RA   Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
RA   Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
RA   Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
RA   Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
RA   Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
RA   Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
RA   Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
RA   Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
RA   Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
RA   Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
RA   Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
RT   "The genome sequence of Drosophila melanogaster.";
RL   Science 287:2185-2195(2000).
RN   [4]
RC   STRAIN=Berkeley;
RX   PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
RA   Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
RA   Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
RA   Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
RA   Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
RA   Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
RA   Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
RA   Lewis S.E.;
RT   "Annotation of the Drosophila melanogaster euchromatic genome: a
RT   systematic review.";
RL   Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
RN   [5]
RC   STRAIN=Berkeley; TISSUE=Embryo;
RX   PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
RA   Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
RA   George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
RA   Rubin G.M., Celniker S.E.;
RT   "A Drosophila full-length cDNA resource.";
RL   Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
RN   [6]
RX   PubMed=8001118; DOI=10.1016/0092-8674(94)90070-1;
RA   Paroush Z., Finley R.L. Jr., Kidd T., Wainwright S.M., Ingham P.W.,
RA   Brent R., Ish-Horowicz D.;
RT   "Groucho is required for Drosophila neurogenesis, segmentation, and
RT   sex determination and interacts directly with hairy-related bHLH
RT   proteins.";
RL   Cell 79:805-815(1994).
RN   [7]
RX   PubMed=8649374;
RA   Fisher A.L., Ohsako S., Caudy M.;
RT   "The WRPW motif of the hairy-related basic helix-loop-helix repressor
RT   proteins acts as a 4-amino-acid transcription repression and protein-
RT   protein interaction domain.";
RL   Mol. Cell. Biol. 16:2670-2677(1996).
RN   [8]
RX   PubMed=14871887; DOI=10.1074/jbc.M310097200;
RA   Secombe J., Parkhurst S.M.;
RT   "Drosophila Topors is a RING finger-containing protein that functions
RT   as a ubiquitin-protein isopeptide ligase for the hairy basic helix-
RT   loop-helix repressor protein.";
RL   J. Biol. Chem. 279:17126-17133(2004).
CC   -!- FUNCTION: Pair-rule protein that regulates embryonic segmentation
CC       and adult bristle patterning. Transcriptional repressor of genes
CC       that require a bHLH protein for their transcription (e.g. the
CC       Fushi tarazu gene). {ECO:0000269|PubMed:8649374}.
CC   -!- SUBUNIT: Transcription repression requires formation of a complex
CC       with a corepressor protein (Groucho). Interacts with gro (via WPRW
CC       motif) and Topors. {ECO:0000269|PubMed:14871887,
CC       ECO:0000269|PubMed:8649374}.
CC       O46036:CtBP; NbExp=4; IntAct=EBI-123011, EBI-159330;
CC       Q9VNJ0:dgrn; NbExp=5; IntAct=EBI-123011, EBI-186615;
CC       P16371:gro; NbExp=3; IntAct=EBI-123011, EBI-153866;
CC       Q9V8P9:Topors; NbExp=4; IntAct=EBI-123011, EBI-147805;
CC       P83949:Ubx; NbExp=3; IntAct=EBI-123011, EBI-202590;
CC   -!- DOMAIN: Has a particular type of basic domain (presence of a
CC       helix-interrupting proline) that binds to the N-box (CACNAG),
CC       rather than the canonical E-box (CANNTG).
CC   -!- DOMAIN: The C-terminal WRPW motif is a transcriptional repression
CC       domain necessary for the interaction with Groucho, a
CC       transcriptional corepressor recruited to specific target DNA by
CC       Hairy-related proteins.
CC   -!- PTM: Ubiquitinated by Topors. {ECO:0000269|PubMed:14871887}.
CC   -!- SIMILARITY: Contains 1 bHLH (basic helix-loop-helix) domain.
CC       {ECO:0000255|PROSITE-ProRule:PRU00981}.
CC   -!- SIMILARITY: Contains 1 Orange domain. {ECO:0000255|PROSITE-
CC       ProRule:PRU00380}.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; X15904; CAA34018.1; -; Genomic_DNA.
DR   EMBL; X15905; CAA34019.1; -; mRNA.
DR   EMBL; AY055833; AAL17767.1; -; Genomic_DNA.
DR   EMBL; AY055834; AAL17768.1; -; Genomic_DNA.
DR   EMBL; AY055835; AAL17769.1; -; Genomic_DNA.
DR   EMBL; AY055836; AAL17770.1; -; Genomic_DNA.
DR   EMBL; AY055837; AAL17771.1; -; Genomic_DNA.
DR   EMBL; AY055838; AAL17772.1; -; Genomic_DNA.
DR   EMBL; AY055839; AAL17773.1; -; Genomic_DNA.
DR   EMBL; AY055840; AAL17774.1; -; Genomic_DNA.
DR   EMBL; AY055841; AAL17775.1; -; Genomic_DNA.
DR   EMBL; AY055842; AAL17776.1; -; Genomic_DNA.
DR   EMBL; AE014296; AAF50378.1; -; Genomic_DNA.
DR   EMBL; AE014296; AAX52752.1; -; Genomic_DNA.
DR   EMBL; AY119633; AAM50287.1; -; mRNA.
DR   PIR; S06956; S06956.
DR   RefSeq; NP_001014577.1; NM_001014577.2.
DR   RefSeq; NP_523977.2; NM_079253.4.
DR   UniGene; Dm.2554; -.
DR   ProteinModelPortal; P14003; -.
DR   SMR; P14003; 23-92.
DR   BioGrid; 64402; 11.
DR   DIP; DIP-637N; -.
DR   IntAct; P14003; 8.
DR   MINT; MINT-1542874; -.
DR   STRING; 7227.FBpp0099504; -.
DR   PaxDb; P14003; -.
DR   GeneID; 38995; -.
DR   KEGG; dme:Dmel_CG6494; -.
DR   UCSC; CG6494-RA; d. melanogaster.
DR   CTD; 38995; -.
DR   FlyBase; FBgn0001168; h.
DR   eggNOG; KOG4304; Eukaryota.
DR   eggNOG; ENOG4111F0X; LUCA.
DR   InParanoid; P14003; -.
DR   KO; K09090; -.
DR   OrthoDB; EOG780RN7; -.
DR   PhylomeDB; P14003; -.
DR   Reactome; R-DME-210744; Regulation of gene expression in late stage (branching morphogenesis) pancreatic bud precursor cells.
DR   Reactome; R-DME-2122947; NOTCH1 Intracellular Domain Regulates Transcription.
DR   SignaLink; P14003; -.
DR   GenomeRNAi; 38995; -.
DR   NextBio; 811370; -.
DR   PRO; PR:P14003; -.
DR   Proteomes; UP000000803; Chromosome 3L.
DR   Bgee; P14003; -.
DR   Genevisible; P14003; DM.
DR   GO; GO:0005634; C:nucleus; IC:UniProtKB.
DR   GO; GO:0003677; F:DNA binding; IDA:UniProtKB.
DR   GO; GO:0070888; F:E-box binding; IDA:FlyBase.
DR   GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IDA:FlyBase.
DR   GO; GO:0008134; F:transcription factor binding; IPI:FlyBase.
DR   GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:FlyBase.
DR   GO; GO:0000902; P:cell morphogenesis; IMP:FlyBase.
DR   GO; GO:0061024; P:membrane organization; TAS:FlyBase.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:UniProtKB.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
DR   GO; GO:0007399; P:nervous system development; TAS:FlyBase.
DR   GO; GO:0007424; P:open tracheal system development; IMP:FlyBase.
DR   GO; GO:0007366; P:periodic partitioning by pair rule gene; NAS:FlyBase.
DR   GO; GO:0035289; P:posterior head segmentation; TAS:FlyBase.
DR   GO; GO:0007460; P:R8 cell fate commitment; NAS:FlyBase.
DR   GO; GO:0031323; P:regulation of cellular metabolic process; IMP:FlyBase.
DR   GO; GO:0001666; P:response to hypoxia; IMP:FlyBase.
DR   GO; GO:0007431; P:salivary gland development; TAS:FlyBase.
DR   GO; GO:0007435; P:salivary gland morphogenesis; IMP:FlyBase.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   GO; GO:0035290; P:trunk segmentation; TAS:FlyBase.
DR   GO; GO:0035239; P:tube morphogenesis; IMP:FlyBase.
DR   Gene3D;; -; 1.
DR   InterPro; IPR011598; bHLH_dom.
DR   InterPro; IPR003650; Orange_dom.
DR   Pfam; PF07527; Hairy_orange; 1.
DR   Pfam; PF00010; HLH; 1.
DR   SMART; SM00353; HLH; 1.
DR   SMART; SM00511; ORANGE; 1.
DR   SUPFAM; SSF47459; SSF47459; 1.
DR   PROSITE; PS50888; BHLH; 1.
PE   1: Evidence at protein level;
KW   Complete proteome; Developmental protein; DNA-binding; Nucleus;
KW   Pair-rule protein; Polymorphism; Reference proteome; Repressor;
KW   Transcription; Transcription regulation; Ubl conjugation.
FT   CHAIN         1    337       Protein hairy.
FT                                /FTId=PRO_0000127181.
FT   DOMAIN       31     88       bHLH. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00981}.
FT   DOMAIN      107    136       Orange. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00380}.
FT   REGION       29     48       Interaction with Topors.
FT   MOTIF       334    337       WRPW motif.
FT   COMPBIAS    149    157       Gln-rich.
FT   COMPBIAS    222    237       Gln-rich.
FT   COMPBIAS    241    250       Poly-Ala.
FT   VARIANT      21     21       A -> S (in strain: R3-6, R3-105 and R3-
FT                                107). {ECO:0000269|PubMed:12242230}.
FT   VARIANT     292    292       P -> S. {ECO:0000269|PubMed:2479541}.
SQ   SEQUENCE   337 AA;  37005 MW;  49BECAF7F2D69FC4 CRC64;
ID   HDAC4_HUMAN             Reviewed;        1084 AA.
AC   P56524; E9PGB9; F5GX36; Q86YH7; Q9UND6;
DT   15-JUL-1998, integrated into UniProtKB/Swiss-Prot.
DT   22-SEP-2009, sequence version 3.
DT   11-NOV-2015, entry version 166.
DE   RecName: Full=Histone deacetylase 4;
DE            Short=HD4;
DE            EC=;
GN   Name=HDAC4; Synonyms=KIAA0288;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RC   TISSUE=Leukemia;
RX   PubMed=10220385; DOI=10.1073/pnas.96.9.4868;
RA   Grozinger C.M., Hassig C.A., Schreiber S.L.;
RT   "Three proteins define a class of human histone deacetylases related
RT   to yeast Hda1p.";
RL   Proc. Natl. Acad. Sci. U.S.A. 96:4868-4873(1999).
RN   [2]
RC   TISSUE=Brain;
RX   PubMed=9179496; DOI=10.1093/dnares/4.1.53;
RA   Ohara O., Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N.,
RA   Nomura N.;
RT   "Construction and characterization of human brain cDNA libraries
RT   suitable for analysis of cDNA clones encoding relatively large
RT   proteins.";
RL   DNA Res. 4:53-59(1997).
RN   [3]
RA   Ohara O., Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N.,
RA   Nomura N.;
RL   Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RX   PubMed=15815621; DOI=10.1038/nature03466;
RA   Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
RA   Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
RA   Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
RA   Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
RA   Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
RA   Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
RA   Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
RA   Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
RA   Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
RA   Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
RA   McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
RA   Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
RA   Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
RA   Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
RA   Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
RA   Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
RA   Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
RA   Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
RA   Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
RA   Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
RA   McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
RA   Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
RA   Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
RA   Waterston R.H., Wilson R.K.;
RT   "Generation and annotation of the DNA sequences of human chromosomes 2
RT   and 4.";
RL   Nature 434:724-731(2005).
RN   [5]
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RC   TISSUE=Testis;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RX   PubMed=10487761; DOI=10.1093/emboj/18.18.5099;
RA   Miska E.A., Karlsson C., Langley E., Nielsen S.J., Pines J.,
RA   Kouzarides T.;
RT   "HDAC4 deacetylase associates with and represses the MEF2
RT   transcription factor.";
RL   EMBO J. 18:5099-5107(1999).
RN   [8]
RP   HIS-803.
RX   PubMed=10523670;
RA   Wang A.H., Bertos N.R., Vezmar M., Pelletier N., Crosato M.,
RA   Heng H.H., Th'ng J., Han J., Yang X.-J.;
RT   "HDAC4, a human histone deacetylase related to yeast HDA1, is a
RT   transcriptional corepressor.";
RL   Mol. Cell. Biol. 19:7816-7827(1999).
RN   [9]
RP   SER-246; SER-467 AND SER-632.
RX   PubMed=10958686; DOI=10.1128/MCB.20.18.6904-6912.2000;
RA   Wang A.H., Kruhlak M.J., Wu J., Bertos N.R., Vezmar M., Posner B.I.,
RA   Bazett-Jones D.P., Yang X.-J.;
RT   "Regulation of histone deacetylase 4 by binding of 14-3-3 proteins.";
RL   Mol. Cell. Biol. 20:6904-6912(2000).
RN   [10]
RP   SER-632.
RX   PubMed=11470791; DOI=10.1074/jbc.M105086200;
RA   Zhao X., Ito A., Kane C.D., Liao T.-S., Bolger T.A., Lemrow S.M.,
RA   Means A.R., Yao T.-P.;
RT   "The modular nature of histone deacetylase HDAC4 confers
RT   phosphorylation-dependent intracellular trafficking.";
RL   J. Biol. Chem. 276:35042-35048(2001).
RN   [11]
RX   PubMed=11509672; DOI=10.1128/MCB.21.18.6312-6321.2001;
RA   McKinsey T.A., Zhang C.-L., Olson E.N.;
RT   "Identification of a signal-responsive nuclear export sequence in
RT   class II histone deacetylases.";
RL   Mol. Cell. Biol. 21:6312-6321(2001).
RN   [12]
RX   PubMed=11463856; DOI=10.1210/me.15.8.1318;
RA   Franco P.J., Farooqui M., Seto E., Wei L.-N.;
RT   "The orphan nuclear receptor TR2 interacts directly with both class I
RT   and class II histone deacetylases.";
RL   Mol. Endocrinol. 15:1318-1328(2001).
RN   [13]
RX   PubMed=12032081; DOI=10.1093/emboj/21.11.2682;
RA   Kirsh O., Seeler J.-S., Pichler A., Gast A., Mueller S., Miska E.,
RA   Mathieu M., Harel-Bellan A., Kouzarides T., Melchior F., Dejean A.;
RT   "The SUMO E3 ligase RanBP2 promotes modification of the HDAC4
RT   deacetylase.";
RL   EMBO J. 21:2682-2691(2002).
RN   [14]
RX   PubMed=17373667; DOI=10.1002/ijc.22673;
RA   Barrett A., Santangelo S., Tan K., Catchpole S., Roberts K.,
RA   Spencer-Dene B., Hall D., Scibetta A., Burchell J., Verdin E.,
RA   Freemont P., Taylor-Papadimitriou J.;
RT   "Breast cancer associated transcriptional repressor PLU-1/JARID1B
RT   interacts directly with histone deacetylases.";
RL   Int. J. Cancer 121:265-275(2007).
RN   [15]
RX   PubMed=17179159; DOI=10.1074/jbc.M604281200;
RA   Little G.H., Bai Y., Williams T., Poizat C.;
RT   "Nuclear calcium/calmodulin-dependent protein kinase IIdelta
RT   preferentially transmits signals to histone deacetylase 4 in cardiac
RT   cells.";
RL   J. Biol. Chem. 282:7219-7231(2007).
RN   [16]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=18669648; DOI=10.1073/pnas.0805139105;
RA   Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
RA   Elledge S.J., Gygi S.P.;
RT   "A quantitative atlas of mitotic phosphorylation.";
RL   Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
RN   [17]
RC   TISSUE=Leukemic T-cell;
RX   PubMed=19690332; DOI=10.1126/scisignal.2000007;
RA   Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
RA   Rodionov V., Han D.K.;
RT   "Quantitative phosphoproteomic analysis of T cell receptor signaling
RT   reveals system-wide modulation of protein-protein interactions.";
RL   Sci. Signal. 2:RA46-RA46(2009).
RN   [18]
RX   PubMed=20691407; DOI=10.1016/j.ajhg.2010.07.011;
RA   Williams S.R., Aldred M.A., Der Kaloustian V.M., Halal F., Gowans G.,
RA   McLeod D.R., Zondag S., Toriello H.V., Magenis R.E., Elsea S.H.;
RT   "Haploinsufficiency of HDAC4 causes brachydactyly mental retardation
RT   syndrome, with brachydactyly type E, developmental delays, and
RT   behavioral problems.";
RL   Am. J. Hum. Genet. 87:219-228(2010).
RN   [19]
RX   PubMed=20110259; DOI=10.1093/nar/gkq006;
RA   Shao Y., Li Y., Zhang J., Liu D., Liu F., Zhao Y., Shen T., Li F.;
RT   "Involvement of histone deacetylation in MORC2-mediated down-
RT   regulation of carbonic anhydrase IX.";
RL   Nucleic Acids Res. 38:2813-2824(2010).
RN   [20]
RC   TISSUE=Cervix carcinoma;
RX   PubMed=20068231; DOI=10.1126/scisignal.2000475;
RA   Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
RA   Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
RA   Mann M.;
RT   "Quantitative phosphoproteomics reveals widespread full
RT   phosphorylation site occupancy during mitosis.";
RL   Sci. Signal. 3:RA3-RA3(2010).
RN   [21]
RX   PubMed=21406692; DOI=10.1126/scisignal.2001570;
RA   Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
RA   Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
RA   Blagoev B.;
RT   "System-wide temporal characterization of the proteome and
RT   phosphoproteome of human embryonic stem cell differentiation.";
RL   Sci. Signal. 4:RS3-RS3(2011).
RN   [22]
RX   PubMed=24413532; DOI=10.1158/0008-5472.CAN-13-2020;
RA   Kang H.J., Lee M.H., Kang H.L., Kim S.H., Ahn J.R., Na H., Na T.Y.,
RA   Kim Y.N., Seong J.K., Lee M.O.;
RT   "Differential regulation of estrogen receptor alpha expression in
RT   breast cancer cells by metastasis-associated protein 1.";
RL   Cancer Res. 74:1484-1494(2014).
RN   [23]
RC   TISSUE=Liver;
RX   PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
RA   Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
RA   Wang L., Ye M., Zou H.;
RT   "An enzyme assisted RP-RPLC approach for in-depth analysis of human
RT   liver phosphoproteome.";
RL   J. Proteomics 96:253-262(2014).
RN   [24]
RX   PubMed=22649097; DOI=10.1126/scisignal.2002979;
RA   Xu C., Jin J., Bian C., Lam R., Tian R., Weist R., You L., Nie J.,
RA   Bochkarev A., Tempel W., Tan C.S., Wasney G.A., Vedadi M., Gish G.D.,
RA   Arrowsmith C.H., Pawson T., Yang X.J., Min J.;
RT   "Sequence-specific recognition of a PxLPxI/L motif by an ankyrin
RT   repeat tumbler lock.";
RL   Sci. Signal. 5:RA39-RA39(2012).
RN   [25]
RX   PubMed=16959974; DOI=10.1126/science.1133427;
RA   Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
RA   Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
RA   Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
RA   Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
RA   Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
RA   Vogelstein B., Kinzler K.W., Velculescu V.E.;
RT   "The consensus coding sequences of human breast and colorectal
RT   cancers.";
RL   Science 314:268-274(2006).
RN   [26]
RX   PubMed=24169519; DOI=10.1038/ejhg.2013.243;
RA   Piton A., Poquet H., Redin C., Masurel A., Lauer J., Muller J.,
RA   Thevenon J., Herenger Y., Chancenotte S., Bonnet M., Pinoit J.M.,
RA   Huet F., Thauvin-Robinet C., Jaeger A.S., Le Gras S., Jost B.,
RA   Gerard B., Peoc'h K., Launay J.M., Faivre L., Mandel J.L.;
RT   "20 ans apres: a second mutation in MAOA identified by targeted high-
RT   throughput sequencing in a family with altered behavior and
RT   cognition.";
RL   Eur. J. Hum. Genet. 22:776-783(2014).
CC   -!- FUNCTION: Responsible for the deacetylation of lysine residues on
CC       the N-terminal part of the core histones (H2A, H2B, H3 and H4).
CC       Histone deacetylation gives a tag for epigenetic repression and
CC       plays an important role in transcriptional regulation, cell cycle
CC       progression and developmental events. Histone deacetylases act via
CC       the formation of large multiprotein complexes. Involved in muscle
CC       maturation via its interaction with the myocyte enhancer factors
CC       such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated
CC       epigenetic regulation of ESR1 expression in breast cancer.
CC       {ECO:0000269|PubMed:10523670, ECO:0000269|PubMed:24413532}.
CC   -!- CATALYTIC ACTIVITY: Hydrolysis of an N(6)-acetyl-lysine residue of
CC       a histone to yield a deacetylated histone.
CC   -!- SUBUNIT: Interacts with HDAC7 (By similarity). Homodimer.
CC       Homodimerization via its N-terminal domain. Interacts with MEF2C,
CC       AHRR, and NR2C1. Interacts with a 14-3-3 chaperone protein in a
CC       phosphorylation dependent manner. Interacts with BTBD14B (By
CC       similarity). Interacts with KDM5B. Interacts with MYOCD (By
CC       similarity). Interacts with MORC2. Interacts with ANKRA2.
CC       Interacts with EP300 in the presence of TFAP2C. {ECO:0000250,
CC       ECO:0000269|PubMed:10487761, ECO:0000269|PubMed:10523670,
CC       ECO:0000269|PubMed:11463856, ECO:0000269|PubMed:17373667,
CC       ECO:0000269|PubMed:20110259, ECO:0000269|PubMed:22649097,
CC       ECO:0000269|PubMed:24413532}.
CC       Q9H9E1:ANKRA2; NbExp=3; IntAct=EBI-308629, EBI-10215533;
CC       P10275:AR; NbExp=4; IntAct=EBI-308629, EBI-608057;
CC       P15336:ATF2; NbExp=2; IntAct=EBI-308629, EBI-1170906;
CC       P41182:BCL6; NbExp=3; IntAct=EBI-308629, EBI-765407;
CC       Q9HCU9:BRMS1; NbExp=2; IntAct=EBI-308629, EBI-714781;
CC       Q96JN2-2:CCDC136; NbExp=3; IntAct=EBI-308629, EBI-10171416;
CC       Q01850:CDR2; NbExp=3; IntAct=EBI-308629, EBI-1181367;
CC       O95967:EFEMP2; NbExp=3; IntAct=EBI-308629, EBI-743414;
CC       Q08379:GOLGA2; NbExp=3; IntAct=EBI-308629, EBI-618309;
CC       P08393:ICP0 (xeno); NbExp=3; IntAct=EBI-308629, EBI-6148881;
CC       Q15323:KRT31; NbExp=3; IntAct=EBI-308629, EBI-948001;
CC       O76015:KRT38; NbExp=3; IntAct=EBI-308629, EBI-1047263;
CC       Q6A162:KRT40; NbExp=3; IntAct=EBI-308629, EBI-10171697;
CC       O95751:LDOC1; NbExp=3; IntAct=EBI-308629, EBI-740738;
CC       A9UHW6:MIF4GD; NbExp=4; IntAct=EBI-308629, EBI-373498;
CC       Q5JR59:MTUS2; NbExp=3; IntAct=EBI-308629, EBI-742948;
CC       Q8ND90:PNMA1; NbExp=3; IntAct=EBI-308629, EBI-302345;
CC       Q6NUQ1:RINT1; NbExp=3; IntAct=EBI-308629, EBI-726876;
CC       Q13761:RUNX3; NbExp=9; IntAct=EBI-308629, EBI-925990;
CC       P31947:SFN; NbExp=4; IntAct=EBI-308629, EBI-476295;
CC       P63279:UBE2I; NbExp=3; IntAct=EBI-308629, EBI-80168;
CC       P31946:YWHAB; NbExp=3; IntAct=EBI-308629, EBI-359815;
CC       P62258:YWHAE; NbExp=4; IntAct=EBI-308629, EBI-356498;
CC       P61981:YWHAG; NbExp=6; IntAct=EBI-308629, EBI-359832;
CC       Q04917:YWHAH; NbExp=3; IntAct=EBI-308629, EBI-306940;
CC       P63104:YWHAZ; NbExp=5; IntAct=EBI-308629, EBI-347088;
CC   -!- SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=Shuttles between
CC       the nucleus and the cytoplasm. Upon muscle cells differentiation,
CC       it accumulates in the nuclei of myotubes, suggesting a positive
CC       role of nuclear HDAC4 in muscle differentiation. The export to
CC       cytoplasm depends on the interaction with a 14-3-3 chaperone
CC       protein and is due to its phosphorylation at Ser-246, Ser-467 and
CC       Ser-632 by CaMK4 and SIK1. The nuclear localization probably
CC       depends on sumoylation.
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=P56524-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=P56524-2; Sequence=VSP_057290, VSP_057291;
CC         Note=No experimental confirmation available.;
CC   -!- TISSUE SPECIFICITY: Ubiquitous.
CC   -!- DOMAIN: The nuclear export sequence mediates the shuttling between
CC       the nucleus and the cytoplasm.
CC   -!- PTM: Phosphorylated by CaMK4 at Ser-246, Ser-467 and Ser-632.
CC       Phosphorylation at other residues by CaMK2D is required for the
CC       interaction with 14-3-3. Phosphorylation at Ser-350 impairs the
CC       binding of ANKRA2 but generates a high-affinity docking site for
CC       14-3-3. {ECO:0000269|PubMed:10958686,
CC       ECO:0000269|PubMed:22649097}.
CC   -!- PTM: Sumoylation on Lys-559 is promoted by the E3 SUMO-protein
CC       ligase RANBP2, and prevented by phosphorylation by CaMK4.
CC       {ECO:0000269|PubMed:12032081}.
CC   -!- DISEASE: Brachydactyly-mental retardation syndrome (BDMR)
CC       [MIM:600430]: A syndrome resembling the physical anomalies found
CC       in Albright hereditary osteodystrophy. Common features are mild
CC       facial dysmorphism, congenital heart defects, distinct
CC       brachydactyly type E, mental retardation, developmental delay,
CC       seizures, autism spectrum disorder, and stocky build. Soft tissue
CC       ossification is absent, and there are no abnormalities in
CC       parathyroid hormone or calcium metabolism.
CC       {ECO:0000269|PubMed:20691407}. Note=The disease is caused by
CC       mutations affecting the gene represented in this entry.
CC   -!- SIMILARITY: Belongs to the histone deacetylase family. HD type 2
CC       subfamily. {ECO:0000305}.
CC       Sequence=BAA22957.2; Type=Erroneous initiation; Evidence={ECO:0000305};
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; AF132607; AAD29046.1; -; mRNA.
DR   EMBL; AB006626; BAA22957.2; ALT_INIT; mRNA.
DR   EMBL; AC017028; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AC062017; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF510800; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF510801; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471063; EAW71165.1; -; Genomic_DNA.
DR   EMBL; BC039904; AAH39904.1; -; mRNA.
DR   CCDS; CCDS2529.1; -. [P56524-1]
DR   RefSeq; NP_006028.2; NM_006037.3. [P56524-1]
DR   UniGene; Hs.20516; -.
DR   PDB; 2H8N; X-ray; 2.60 A; A/B/C/D=62-153.
DR   PDB; 2O94; X-ray; 3.00 A; A/B/C/D=62-153.
DR   PDB; 2VQJ; X-ray; 2.10 A; A=648-1057.
DR   PDB; 2VQM; X-ray; 1.80 A; A=648-1057.
DR   PDB; 2VQO; X-ray; 2.15 A; A/B=648-1057.
DR   PDB; 2VQQ; X-ray; 1.90 A; A/B=648-1057.
DR   PDB; 2VQV; X-ray; 3.30 A; A/B=648-1057.
DR   PDB; 2VQW; X-ray; 3.00 A; G=648-1057.
DR   PDB; 3UXG; X-ray; 1.85 A; B=343-359.
DR   PDB; 3UZD; X-ray; 1.86 A; B=343-359.
DR   PDB; 3V31; X-ray; 1.57 A; B=343-359.
DR   PDB; 4CBT; X-ray; 3.03 A; A/B/C=648-1033.
DR   PDB; 4CBY; X-ray; 2.72 A; A/B/C/D=648-1033.
DR   PDBsum; 2H8N; -.
DR   PDBsum; 2O94; -.
DR   PDBsum; 2VQJ; -.
DR   PDBsum; 2VQM; -.
DR   PDBsum; 2VQO; -.
DR   PDBsum; 2VQQ; -.
DR   PDBsum; 2VQV; -.
DR   PDBsum; 2VQW; -.
DR   PDBsum; 3UXG; -.
DR   PDBsum; 3UZD; -.
DR   PDBsum; 3V31; -.
DR   PDBsum; 4CBT; -.
DR   PDBsum; 4CBY; -.
DR   ProteinModelPortal; P56524; -.
DR   SMR; P56524; 62-129, 650-1051.
DR   BioGrid; 115106; 138.
DR   DIP; DIP-34565N; -.
DR   IntAct; P56524; 43.
DR   MINT; MINT-104901; -.
DR   STRING; 9606.ENSP00000264606; -.
DR   BindingDB; P56524; -.
DR   ChEMBL; CHEMBL3524; -.
DR   GuidetoPHARMACOLOGY; 2659; -.
DR   PhosphoSite; P56524; -.
DR   BioMuta; HDAC4; -.
DR   DMDM; 259016348; -.
DR   MaxQB; P56524; -.
DR   PaxDb; P56524; -.
DR   PRIDE; P56524; -.
DR   Ensembl; ENST00000345617; ENSP00000264606; ENSG00000068024. [P56524-1]
DR   Ensembl; ENST00000543185; ENSP00000440481; ENSG00000068024. [P56524-2]
DR   GeneID; 9759; -.
DR   KEGG; hsa:9759; -.
DR   UCSC; uc002vyk.4; human. [P56524-1]
DR   CTD; 9759; -.
DR   GeneCards; HDAC4; -.
DR   GeneReviews; HDAC4; -.
DR   HGNC; HGNC:14063; HDAC4.
DR   HPA; CAB004431; -.
DR   HPA; HPA048723; -.
DR   MIM; 600430; phenotype.
DR   MIM; 605314; gene.
DR   neXtProt; NX_P56524; -.
DR   Orphanet; 1001; 2q37 microdeletion syndrome.
DR   PharmGKB; PA29229; -.
DR   eggNOG; KOG1343; Eukaryota.
DR   eggNOG; COG0123; LUCA.
DR   GeneTree; ENSGT00530000062809; -.
DR   HOGENOM; HOG000232065; -.
DR   HOVERGEN; HBG057100; -.
DR   InParanoid; P56524; -.
DR   KO; K11406; -.
DR   OrthoDB; EOG7RFTH5; -.
DR   PhylomeDB; P56524; -.
DR   TreeFam; TF106174; -.
DR   BRENDA;; 2681.
DR   Reactome; R-HSA-2122947; NOTCH1 Intracellular Domain Regulates Transcription.
DR   Reactome; R-HSA-2644606; Constitutive Signaling by NOTCH1 PEST Domain Mutants.
DR   Reactome; R-HSA-2894862; Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants.
DR   ChiTaRS; HDAC4; human.
DR   EvolutionaryTrace; P56524; -.
DR   GeneWiki; HDAC4; -.
DR   GenomeRNAi; 9759; -.
DR   NextBio; 35507317; -.
DR   PRO; PR:P56524; -.
DR   Proteomes; UP000005640; Chromosome 2.
DR   Bgee; P56524; -.
DR   CleanEx; HS_HDAC4; -.
DR   ExpressionAtlas; P56524; baseline and differential.
DR   Genevisible; P56524; HS.
DR   GO; GO:0031672; C:A band; IEA:Ensembl.
DR   GO; GO:0042641; C:actomyosin; IEA:Ensembl.
DR   GO; GO:0005737; C:cytoplasm; IDA:BHF-UCL.
DR   GO; GO:0005829; C:cytosol; IEA:Ensembl.
DR   GO; GO:0000118; C:histone deacetylase complex; IDA:BHF-UCL.
DR   GO; GO:0031594; C:neuromuscular junction; IEA:Ensembl.
DR   GO; GO:0005654; C:nucleoplasm; IDA:HPA.
DR   GO; GO:0005634; C:nucleus; IDA:UniProtKB.
DR   GO; GO:0017053; C:transcriptional repressor complex; IDA:BHF-UCL.
DR   GO; GO:0030018; C:Z disc; IEA:Ensembl.
DR   GO; GO:0033613; F:activating transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0003682; F:chromatin binding; IEA:Ensembl.
DR   GO; GO:0001047; F:core promoter binding; IDA:UniProtKB.
DR   GO; GO:0004407; F:histone deacetylase activity; IDA:BHF-UCL.
DR   GO; GO:0042826; F:histone deacetylase binding; IPI:BHF-UCL.
DR   GO; GO:0032041; F:NAD-dependent histone deacetylase activity (H3-K14 specific); IEA:UniProtKB-EC.
DR   GO; GO:0030955; F:potassium ion binding; IDA:BHF-UCL.
DR   GO; GO:0033558; F:protein deacetylase activity; IDA:BHF-UCL.
DR   GO; GO:0070491; F:repressing transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0001025; F:RNA polymerase III transcription factor binding; IPI:UniProtKB.
DR   GO; GO:0003714; F:transcription corepressor activity; IEA:Ensembl.
DR   GO; GO:0008134; F:transcription factor binding; IPI:BHF-UCL.
DR   GO; GO:0008270; F:zinc ion binding; IDA:BHF-UCL.
DR   GO; GO:0042113; P:B cell activation; TAS:UniProtKB.
DR   GO; GO:0030183; P:B cell differentiation; TAS:UniProtKB.
DR   GO; GO:0014898; P:cardiac muscle hypertrophy in response to stress; TAS:BHF-UCL.
DR   GO; GO:0071260; P:cellular response to mechanical stimulus; IEA:Ensembl.
DR   GO; GO:0071374; P:cellular response to parathyroid hormone stimulus; IEA:Ensembl.
DR   GO; GO:0071356; P:cellular response to tumor necrosis factor; IEA:Ensembl.
DR   GO; GO:0006338; P:chromatin remodeling; IDA:BHF-UCL.
DR   GO; GO:0016575; P:histone deacetylation; IDA:BHF-UCL.
DR   GO; GO:0070932; P:histone H3 deacetylation; IDA:BHF-UCL.
DR   GO; GO:0070933; P:histone H4 deacetylation; IDA:BHF-UCL.
DR   GO; GO:0006954; P:inflammatory response; TAS:UniProtKB.
DR   GO; GO:0008285; P:negative regulation of cell proliferation; IEA:Ensembl.
DR   GO; GO:0045820; P:negative regulation of glycolytic process; ISS:BHF-UCL.
DR   GO; GO:0010832; P:negative regulation of myotube differentiation; IMP:BHF-UCL.
DR   GO; GO:0045668; P:negative regulation of osteoblast differentiation; IEA:Ensembl.
DR   GO; GO:0043433; P:negative regulation of sequence-specific DNA binding transcription factor activity; IMP:BHF-UCL.
DR   GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:BHF-UCL.
DR   GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:BHF-UCL.
DR   GO; GO:0007399; P:nervous system development; TAS:UniProtKB.
DR   GO; GO:0002076; P:osteoblast development; IEA:Ensembl.
DR   GO; GO:0034983; P:peptidyl-lysine deacetylation; IDA:BHF-UCL.
DR   GO; GO:0008284; P:positive regulation of cell proliferation; IMP:BHF-UCL.
DR   GO; GO:0010592; P:positive regulation of lamellipodium assembly; IEA:Ensembl.
DR   GO; GO:0043525; P:positive regulation of neuron apoptotic process; IEA:Ensembl.
DR   GO; GO:0033235; P:positive regulation of protein sumoylation; IDA:UniProtKB.
DR   GO; GO:1903428; P:positive regulation of reactive oxygen species biosynthetic process; IEA:Ensembl.
DR   GO; GO:0051091; P:positive regulation of sequence-specific DNA binding transcription factor activity; IMP:BHF-UCL.
DR   GO; GO:0014911; P:positive regulation of smooth muscle cell migration; IEA:Ensembl.
DR   GO; GO:0048661; P:positive regulation of smooth muscle cell proliferation; IEA:Ensembl.
DR   GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IMP:BHF-UCL.
DR   GO; GO:0045893; P:positive regulation of transcription, DNA-templated; ISS:BHF-UCL.
DR   GO; GO:0010882; P:regulation of cardiac muscle contraction by calcium ion signaling; IEA:Ensembl.
DR   GO; GO:0040029; P:regulation of gene expression, epigenetic; IMP:UniProtKB.
DR   GO; GO:0043393; P:regulation of protein binding; IMP:BHF-UCL.
DR   GO; GO:0048742; P:regulation of skeletal muscle fiber development; IEA:Ensembl.
DR   GO; GO:0014894; P:response to denervation involved in regulation of muscle adaptation; ISS:BHF-UCL.
DR   GO; GO:0042493; P:response to drug; IEA:Ensembl.
DR   GO; GO:0070555; P:response to interleukin-1; IMP:BHF-UCL.
DR   GO; GO:0001501; P:skeletal system development; IEA:Ensembl.
DR   GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
DR   Gene3D; 3.40.800.20; -; 1.
DR   InterPro; IPR000286; His_deacetylse.
DR   InterPro; IPR023801; His_deacetylse_dom.
DR   InterPro; IPR024643; Hist_deacetylase_Gln_rich_N.
DR   InterPro; IPR017320; Histone_deAcase_II_euk.
DR   PANTHER; PTHR10625; PTHR10625; 1.
DR   Pfam; PF12203; HDAC4_Gln; 1.
DR   Pfam; PF00850; Hist_deacetyl; 1.
DR   PIRSF; PIRSF037911; HDAC_II_euk; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Alternative splicing; Autism spectrum disorder;
KW   Chromatin regulator; Coiled coil; Complete proteome; Cytoplasm;
KW   Hydrolase; Isopeptide bond; Mental retardation; Metal-binding;
KW   Nucleus; Phosphoprotein; Polymorphism; Reference proteome; Repressor;
KW   Transcription; Transcription regulation; Ubl conjugation; Zinc.
FT   CHAIN         1   1084       Histone deacetylase 4.
FT                                /FTId=PRO_0000114699.
FT   REGION      118    313       Interaction with MEF2A.
FT   REGION      655   1084       Histone deacetylase.
FT   COILED       67    177       {ECO:0000255}.
FT   MOTIF      1051   1084       Nuclear export signal. {ECO:0000250}.
FT   ACT_SITE    803    803       {ECO:0000250}.
FT   METAL       667    667       Zinc. {ECO:0000250}.
FT   METAL       669    669       Zinc. {ECO:0000250}.
FT   METAL       675    675       Zinc. {ECO:0000250}.
FT   METAL       751    751       Zinc. {ECO:0000250}.
FT   MOD_RES     210    210       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:Q6NZM9}.
FT   MOD_RES     246    246       Phosphoserine; by CaMK4 and SIK1.
FT                                {ECO:0000269|PubMed:10958686}.
FT   MOD_RES     350    350       Phosphoserine.
FT                                {ECO:0000244|PubMed:19690332,
FT                                ECO:0000269|PubMed:22649097}.
FT   MOD_RES     467    467       Phosphoserine; by CaMK4 and SIK1.
FT                                {ECO:0000269|PubMed:10958686}.
FT   MOD_RES     565    565       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:Q6NZM9}.
FT   MOD_RES     632    632       Phosphoserine; by CaMK4.
FT                                {ECO:0000244|PubMed:18669648,
FT                                ECO:0000244|PubMed:24275569,
FT                                ECO:0000269|PubMed:10958686}.
FT   MOD_RES     633    633       Phosphoserine.
FT                                {ECO:0000244|PubMed:18669648}.
FT   CROSSLNK    559    559       Glycyl lysine isopeptide (Lys-Gly)
FT                                (interchain with G-Cter in SUMO).
FT   VAR_SEQ       1    117       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_057290.
FT   VAR_SEQ     431    431       T -> TDWYLS (in isoform 2).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_057291.
FT   VARIANT     727    727       P -> R (in a breast cancer sample;
FT                                somatic mutation).
FT                                {ECO:0000269|PubMed:16959974}.
FT                                /FTId=VAR_036042.
FT   VARIANT     754    754       V -> I. {ECO:0000269|PubMed:24169519}.
FT                                /FTId=VAR_071965.
FT   MUTAGEN     246    246       S->A: Reduces phosphorylation and its
FT                                subsequent nuclear export.
FT                                {ECO:0000269|PubMed:10958686}.
FT   MUTAGEN     467    467       S->A: Reduces phosphorylation and its
FT                                subsequent nuclear export.
FT                                {ECO:0000269|PubMed:10958686,
FT                                ECO:0000269|PubMed:11470791}.
FT   MUTAGEN     559    559       K->R: Abolishes sumoylation and reduces
FT                                the histone deacetylase activity.
FT                                {ECO:0000269|PubMed:12032081}.
FT   MUTAGEN     632    632       S->A: Reduces phosphorylation and its
FT                                subsequent nuclear export.
FT                                {ECO:0000269|PubMed:10958686,
FT                                ECO:0000269|PubMed:11470791}.
FT   MUTAGEN     803    803       H->L: Abolishes histone deacetylase
FT                                activity. {ECO:0000269|PubMed:10523670}.
FT   MUTAGEN    1056   1056       V->A: Reduces CaMK-dependent nuclear
FT                                export. {ECO:0000269|PubMed:11509672}.
FT   MUTAGEN    1062   1062       L->A: Reduces CaMK-dependent nuclear
FT                                export. {ECO:0000269|PubMed:11509672}.
FT   CONFLICT    373    373       A -> T (in Ref. 1; AAD29046 and 2;
FT                                BAA22957). {ECO:0000305}.
FT   HELIX        64    112       {ECO:0000244|PDB:2H8N}.
FT   HELIX       115    121       {ECO:0000244|PDB:2H8N}.
FT   TURN        122    125       {ECO:0000244|PDB:2H8N}.
FT   HELIX       126    128       {ECO:0000244|PDB:2H8N}.
FT   TURN        354    357       {ECO:0000244|PDB:3UXG}.
FT   STRAND      652    657       {ECO:0000244|PDB:2VQM}.
FT   HELIX       660    662       {ECO:0000244|PDB:2VQM}.
FT   STRAND      673    675       {ECO:0000244|PDB:2VQJ}.
FT   HELIX       681    691       {ECO:0000244|PDB:2VQM}.
FT   HELIX       694    697       {ECO:0000244|PDB:2VQM}.
FT   STRAND      698    701       {ECO:0000244|PDB:2VQM}.
FT   HELIX       708    711       {ECO:0000244|PDB:2VQM}.
FT   TURN        712    714       {ECO:0000244|PDB:2VQM}.
FT   HELIX       717    724       {ECO:0000244|PDB:2VQM}.
FT   HELIX       727    730       {ECO:0000244|PDB:2VQM}.
FT   HELIX       737    745       {ECO:0000244|PDB:2VQM}.
FT   STRAND      746    748       {ECO:0000244|PDB:2VQM}.
FT   STRAND      754    756       {ECO:0000244|PDB:2VQM}.
FT   HELIX       762    786       {ECO:0000244|PDB:2VQM}.
FT   STRAND      789    795       {ECO:0000244|PDB:2VQM}.
FT   STRAND      813    815       {ECO:0000244|PDB:2VQM}.
FT   HELIX       817    828       {ECO:0000244|PDB:2VQM}.
FT   STRAND      834    838       {ECO:0000244|PDB:2VQM}.
FT   STRAND      840    842       {ECO:0000244|PDB:2VQM}.
FT   HELIX       845    851       {ECO:0000244|PDB:2VQM}.
FT   STRAND      857    864       {ECO:0000244|PDB:2VQM}.
FT   HELIX       866    868       {ECO:0000244|PDB:2VQM}.
FT   STRAND      870    872       {ECO:0000244|PDB:4CBT}.
FT   HELIX       883    885       {ECO:0000244|PDB:2VQM}.
FT   STRAND      889    894       {ECO:0000244|PDB:2VQM}.
FT   STRAND      898    900       {ECO:0000244|PDB:2VQM}.
FT   HELIX       904    913       {ECO:0000244|PDB:2VQM}.
FT   HELIX       915    922       {ECO:0000244|PDB:2VQM}.
FT   STRAND      925    931       {ECO:0000244|PDB:2VQM}.
FT   STRAND      936    938       {ECO:0000244|PDB:2VQM}.
FT   TURN        940    943       {ECO:0000244|PDB:2VQM}.
FT   HELIX       950    961       {ECO:0000244|PDB:2VQM}.
FT   HELIX       964    966       {ECO:0000244|PDB:2VQM}.
FT   STRAND      968    972       {ECO:0000244|PDB:2VQM}.
FT   HELIX       978    992       {ECO:0000244|PDB:2VQM}.
FT   HELIX      1002   1006       {ECO:0000244|PDB:2VQM}.
FT   HELIX      1011   1025       {ECO:0000244|PDB:2VQM}.
FT   HELIX      1029   1031       {ECO:0000244|PDB:2VQM}.
FT   HELIX      1042   1047       {ECO:0000244|PDB:2VQM}.
SQ   SEQUENCE   1084 AA;  119040 MW;  BB7FD37652D12398 CRC64;
ID   HDAC5_HUMAN             Reviewed;        1122 AA.
AC   Q9UQL6; C9JFV9; O60340; O60528; Q96DY4;
DT   01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
DT   18-MAY-2010, sequence version 2.
DT   11-NOV-2015, entry version 167.
DE   RecName: Full=Histone deacetylase 5;
DE            Short=HD5;
DE            EC=;
DE   AltName: Full=Antigen NY-CO-9;
GN   Name=HDAC5; Synonyms=KIAA0600;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RX   PubMed=10220385; DOI=10.1073/pnas.96.9.4868;
RA   Grozinger C.M., Hassig C.A., Schreiber S.L.;
RT   "Three proteins define a class of human histone deacetylases related
RT   to yeast Hda1p.";
RL   Proc. Natl. Acad. Sci. U.S.A. 96:4868-4873(1999).
RN   [2]
RC   TISSUE=Brain;
RX   PubMed=9628581; DOI=10.1093/dnares/5.1.31;
RA   Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N.,
RA   Ohara O.;
RT   "Prediction of the coding sequences of unide